DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kappaTry and CG17571

DIOPT Version :10

Sequence 1:NP_610674.5 Gene:kappaTry / 36215 FlyBaseID:FBgn0043471 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_610109.1 Gene:CG17571 / 35409 FlyBaseID:FBgn0259998 Length:258 Species:Drosophila melanogaster


Alignment Length:46 Identity:11/46 - (23%)
Similarity:17/46 - (36%) Gaps:6/46 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   294 FRYEEGIPKEIVLFDW-QVMRYVTPVQDLMYFIF-----CCTDGEF 333
            |..:..:||:.|.|.: ..:|......:|.|...     ...||.|
  Fly    58 FIIDYNVPKKDVRFQFMNTIRIAEKPLNLTYIHMRGDNRTIVDGSF 103

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kappaTryNP_610674.5 Tryp_SPc 26..256 CDD:238113
CG17571NP_610109.1 Tryp_SPc 30..251 CDD:214473 11/46 (24%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.