DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kappaTry and CG11911

DIOPT Version :9

Sequence 1:NP_610674.5 Gene:kappaTry / 36215 FlyBaseID:FBgn0043471 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_608518.1 Gene:CG11911 / 33206 FlyBaseID:FBgn0031249 Length:277 Species:Drosophila melanogaster


Alignment Length:261 Identity:73/261 - (27%)
Similarity:116/261 - (44%) Gaps:60/261 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 GRIINGTTVDIARHPYLVSLRYRRDNESSYMHECAGVIISEQALITSAQCLYGLPEETKLVAVAG 88
            |.:||||..:....||:|||   ..|...:.|.|.|.:|::..::|:|.|   :.|...:..:||
  Fly    35 GFVINGTEAEPHSAPYIVSL---ATNYLKHSHICGGTLINKDWIVTAAHC---ISEPVGMSIIAG 93

  Fly    89 ANTRNGTD----------GFIYPVANWTHHPNYDPVTVDNDIGVLLLDTTL-------DLTLLGI 136
            .:||...|          |.:        |..|.......||.:|.::.:.       ..||   
  Fly    94 LHTRAEVDELTQQRQVDFGRV--------HEKYTGGVGPYDIALLHVNESFIFNEWVQPATL--- 147

  Fly   137 SSIGIRPERPAVGRLAT-VAGWGYREEWGPSSY------KLEQTEVPVVSSEQC-TQIYGAGEVT 193
                  |.|..|....| :.|||.     |.||      .|:.....:::.|:| .::..:..:.
  Fly   148 ------PSREQVHEGETHLYGWGQ-----PKSYIFSGAKTLQTVTTQILNYEECKEELPESAPIA 201

  Fly   194 ERMICAGFVVQGGSDACQGDTGGPLVID-----GQLVGLVSWGR-GCARPNYPTVYCYVASFVDW 252
            |..||:..:.|..| ||.||:|||||::     .:|:|:||||. .|...|.|::|..|::::||
  Fly   202 ESNICSSSLQQSKS-ACNGDSGGPLVVEFTNAPSELIGIVSWGYIPCGLANMPSIYTKVSAYIDW 265

  Fly   253 I 253
            |
  Fly   266 I 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kappaTryNP_610674.5 Tryp_SPc 25..253 CDD:214473 70/258 (27%)
Tryp_SPc 26..256 CDD:238113 72/259 (28%)
CG11911NP_608518.1 Tryp_SPc 37..269 CDD:238113 72/259 (28%)
Tryp_SPc 37..266 CDD:214473 70/257 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.