DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kappaTry and Tmprss9

DIOPT Version :9

Sequence 1:NP_610674.5 Gene:kappaTry / 36215 FlyBaseID:FBgn0043471 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_001382445.1 Gene:Tmprss9 / 314636 RGDID:1309581 Length:1095 Species:Rattus norvegicus


Alignment Length:262 Identity:90/262 - (34%)
Similarity:133/262 - (50%) Gaps:31/262 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 FSSVISISGQPEG---RIINGTTVDIARHPYLVSLRYRRDNESSYMHECAGVIISEQALITSAQC 73
            ||.:......|.|   ||:.|:...:...|:.|||..||..     |.|..|:::|:.|:::|.|
  Rat   847 FSHLPDCGLAPPGALTRIVGGSAASLGEWPWQVSLWLRRRE-----HRCGAVLVAERWLLSAAHC 906

  Fly    74 --LYGLPEETKLVAVAGANTRNGTDGFIYPVANWTHHPNYDPVTVDNDIGVLLLDTTLDLTLLGI 136
              :||.|  .:..|..|....:.|:|.:..||....||.|:..|:|.|:.:|.|...:..:.|  
  Rat   907 FDVYGDP--MQWAAFLGTPFLSSTEGQLERVARIYRHPFYNIYTLDYDVALLELAGPVRRSRL-- 967

  Fly   137 SSIGIR------PERPAVGRLATVAGWGYREEWGPSSYKLEQTEVPVVSSEQCTQIYGAGEVTER 195
                :|      |.||..|....:.|||...|.|..:.:|::..|.|:|.:.|.:.|.. :::.|
  Rat   968 ----VRPICLPGPTRPPEGARCVITGWGSLREGGSMARQLQKAAVRVLSEQTCRRFYPV-QISSR 1027

  Fly   196 MICAGFVVQGGSDACQGDTGGPLVI---DGQ--LVGLVSWGRGCARPNYPTVYCYVASFVDWIEE 255
            |:|||| .|||.|:|.||.||||..   .||  |.|:.|||.||.||::|.||..||:.:.||.:
  Rat  1028 MLCAGF-PQGGVDSCSGDAGGPLACREPSGQWVLTGVTSWGYGCGRPHFPGVYTRVAAVLGWIGQ 1091

  Fly   256 TI 257
            .|
  Rat  1092 NI 1093

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kappaTryNP_610674.5 Tryp_SPc 25..253 CDD:214473 83/240 (35%)
Tryp_SPc 26..256 CDD:238113 84/242 (35%)
Tmprss9NP_001382445.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.