DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kappaTry and Klk8

DIOPT Version :9

Sequence 1:NP_610674.5 Gene:kappaTry / 36215 FlyBaseID:FBgn0043471 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_001100979.1 Gene:Klk8 / 308565 RGDID:1305998 Length:260 Species:Rattus norvegicus


Alignment Length:215 Identity:67/215 - (31%)
Similarity:110/215 - (51%) Gaps:30/215 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 CAGVIISEQALITSAQCLYGLPEETKLVAVAGANTRNGTDGFIYP-----VANWTHHPNY---DP 113
            |.||::.::.::|:|.|     ::.|.....|.::....|   .|     ||....||.:   :|
  Rat    58 CGGVLVGDRWVLTAAHC-----KKDKYSVRLGDHSLQKRD---EPEQEIQVARSIQHPCFNSSNP 114

  Fly   114 VTVDNDIGVLLLDTTLDLTLLG--ISSIGIRPERPAVGRLATVAGWG---YREEWGPSSYKLEQT 173
            ....:||.::.|..:.:   ||  :..|.:....|.||:...::|||   ..:|..|::  |...
  Rat   115 EDHSHDIMLIRLQNSAN---LGDKVKPIELANLCPKVGQKCIISGWGTVTSPQENFPNT--LNCA 174

  Fly   174 EVPVVSSEQCTQIYGAGEVTERMICAGFVVQGGSDACQGDTGGPLVIDGQLVGLVSWGRG-CARP 237
            ||.:.|..:|.:.| .|::||.|:|||  ...|:|.||||:|||||.:|.|.|:.|||.. |.:|
  Rat   175 EVKIYSQNKCERAY-PGKITEGMVCAG--SSNGADTCQGDSGGPLVCNGVLQGITSWGSDPCGKP 236

  Fly   238 NYPTVYCYVASFVDWIEETI 257
            ..|.||..:..:.:||::|:
  Rat   237 EKPGVYTKICRYTNWIKKTM 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kappaTryNP_610674.5 Tryp_SPc 25..253 CDD:214473 64/209 (31%)
Tryp_SPc 26..256 CDD:238113 66/212 (31%)
Klk8NP_001100979.1 Tryp_SPc 32..252 CDD:214473 64/209 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.