DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kappaTry and Tmprss11e

DIOPT Version :9

Sequence 1:NP_610674.5 Gene:kappaTry / 36215 FlyBaseID:FBgn0043471 Length:263 Species:Drosophila melanogaster
Sequence 2:XP_038948843.1 Gene:Tmprss11e / 305265 RGDID:1561698 Length:444 Species:Rattus norvegicus


Alignment Length:250 Identity:78/250 - (31%)
Similarity:118/250 - (47%) Gaps:32/250 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 SGQPEGRIINGTTVDIARHPYLVSLRYRRDNESSYMHECAGVIISEQALITSAQCLYGLPEETKL 83
            :.|...||:.||:.:....|:..||::    :.|  |.|...:||...|:::|.|.....:.::.
  Rat   206 TAQTSVRIVGGTSAEEGEWPWQSSLQW----DGS--HRCGATLISNTWLVSAAHCFRTHKDPSRW 264

  Fly    84 VAVAGANTR--NGTDGFIYPVANWTHHPNYDPVTVDNDIGVLLLDTTLDLT------LLGISSIG 140
            .|..||..:  ..|.|    :.....|..|:..:.|.||.::.|...:..|      .|..::..
  Rat   265 TASFGATLQPPKLTTG----IRRIIVHEKYNYPSHDYDIALVELSRPVPCTNAVHKVCLPDANHE 325

  Fly   141 IRPERPAVGRLATVAGWGYREEWGPSSYKLEQTEVPVVSSEQCT--QIYGAGEVTERMICAGFVV 203
            .:|     |:...|.|:|.....|.:...|.|.:|..:.::.|.  |.|. |.:|.||:|||| :
  Rat   326 FQP-----GQRMFVTGFGALRNDGFAQNYLRQVQVDYIDTQTCNRPQSYN-GAITPRMLCAGF-L 383

  Fly   204 QGGSDACQGDTGGPLVIDG-----QLVGLVSWGRGCARPNYPTVYCYVASFVDWI 253
            :|..||||||:|||||...     .|.|:||||..|.:||.|.||..|.:|.|||
  Rat   384 KGEKDACQGDSGGPLVTPDVRDVWYLAGVVSWGDECGQPNKPGVYTRVTAFRDWI 438

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kappaTryNP_610674.5 Tryp_SPc 25..253 CDD:214473 75/242 (31%)
Tryp_SPc 26..256 CDD:238113 75/242 (31%)
Tmprss11eXP_038948843.1 SEA 71..176 CDD:396113
Tryp_SPc 213..441 CDD:238113 75/242 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.