DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kappaTry and Klk1c10

DIOPT Version :9

Sequence 1:NP_610674.5 Gene:kappaTry / 36215 FlyBaseID:FBgn0043471 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_001128645.1 Gene:Klk1c10 / 292858 RGDID:1561403 Length:259 Species:Rattus norvegicus


Alignment Length:273 Identity:85/273 - (31%)
Similarity:130/273 - (47%) Gaps:42/273 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LLLLAIGFSSVISISGQPEG--RIINGTTVDIARHPYLVSLRYRRDNESSYMHECAGVIISEQAL 67
            :|.||:   |:..|...|.|  ||:.|...:....|:.|::    .||  |:  |.||:|....:
  Rat     5 ILFLAL---SLGGIDAAPPGQSRIVGGYKCEKNSQPWQVAI----INE--YL--CGGVLIDPSWV 58

  Fly    68 ITSAQCLYGLPEETKLVAVAGANTRNGTDGFI-YPVANWTH-HPNYDPVTV-----------DND 119
            ||:|.|.     ......:.|.|.....:.|. |...|.:. ||:|.|..:           .||
  Rat    59 ITAAHCY-----SNYYHVLLGRNNLFEDEPFAQYRFVNQSFPHPDYKPFLMRNHTRQRGDDYSND 118

  Fly   120 IGVLLLDTTLDLTLLGISSIGIRPERPAVGRLATVAGWGYREEWGPSSYK----LEQTEVPVVSS 180
            :.:|.|....|:| .|:..|.:..|.|.||.....:|||..:   |.:::    |:...:.::|:
  Rat   119 LMLLHLSEPADIT-DGVKVIDLPTEEPKVGSTCLASGWGSTK---PLNWELPDDLQCVNIHLLSN 179

  Fly   181 EQCTQIYGAGEVTERMICAGFVVQGGSDACQGDTGGPLVIDGQLVGLVSWGR-GCARPNYPTVYC 244
            |:|.:.| ..:||:.|:||| .:.|..|.|:||:||||:.||.|.|:.|||. .||.|..|.||.
  Rat   180 EKCIEAY-EQKVTDLMLCAG-EMDGRKDTCKGDSGGPLICDGVLQGITSWGNVPCAEPYNPGVYT 242

  Fly   245 YVASFVDWIEETI 257
            .:..|..||:|.:
  Rat   243 KLIKFTSWIKEVM 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kappaTryNP_610674.5 Tryp_SPc 25..253 CDD:214473 75/245 (31%)
Tryp_SPc 26..256 CDD:238113 76/247 (31%)
Klk1c10NP_001128645.1 Tryp_SPc 24..251 CDD:214473 75/245 (31%)
Tryp_SPc 25..254 CDD:238113 76/247 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.