DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kappaTry and Mcpt2

DIOPT Version :9

Sequence 1:NP_610674.5 Gene:kappaTry / 36215 FlyBaseID:FBgn0043471 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_742041.1 Gene:Mcpt2 / 29266 RGDID:621058 Length:247 Species:Rattus norvegicus


Alignment Length:277 Identity:76/277 - (27%)
Similarity:113/277 - (40%) Gaps:62/277 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LLLLAIGFSSVISISGQPEGRIINGTTVDIARHPYLVSLRYRRD--NESSYMHECAGVIISEQAL 67
            |.|:|:     :..||.....||.|........||:..|    |  .|......|.|.:||.|.:
  Rat     5 LFLMAL-----LLPSGAGAEEIIGGVESIPHSRPYMAHL----DIVTEKGLRVICGGFLISRQFV 60

  Fly    68 ITSAQCLYGLPEETKLVAVAGAN---TRNGTDGFIYPVANWTHHPNYDPVTVDNDIGVLLLDTTL 129
            :|:|.|     :..::..:.||:   .|..|...| .|.....|.:|:.|...:||.:|.|:..:
  Rat    61 LTAAHC-----KGREITVILGAHDVRKRESTQQKI-KVEKQIIHESYNSVPNLHDIMLLKLEKKV 119

  Fly   130 DLTLLGISSIGIRPERPAV--------------GRLATVAGWGYREEWGPSSYKLEQTEVPVVSS 180
            :||             |||              |.:...||||......|:||.|.:.|:.::..
  Rat   120 ELT-------------PAVNVVPLPSPSDFIHPGAMCWAAGWGKTGVRDPTSYTLREVELRIMDE 171

  Fly   181 EQCTQIYGAGEVTERMICAGFVVQGGSD-----ACQGDTGGPLVIDGQLVGLVSWGRGCARPNYP 240
            :.|        |..|.....|.|..||.     |..||:||||:..|...|:||:|...|:|  |
  Rat   172 KAC--------VDYRYYEYKFQVCVGSPTTLRAAFMGDSGGPLLCAGVAHGIVSYGHPDAKP--P 226

  Fly   241 TVYCYVASFVDWIEETI 257
            .::..|:::|.||...|
  Rat   227 AIFTRVSTYVPWINAVI 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kappaTryNP_610674.5 Tryp_SPc 25..253 CDD:214473 68/251 (27%)
Tryp_SPc 26..256 CDD:238113 70/253 (28%)
Mcpt2NP_742041.1 Tryp_SPc 20..239 CDD:214473 68/251 (27%)
Tryp_SPc 21..242 CDD:238113 70/253 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.