DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kappaTry and TMPRSS11E

DIOPT Version :9

Sequence 1:NP_610674.5 Gene:kappaTry / 36215 FlyBaseID:FBgn0043471 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_054777.2 Gene:TMPRSS11E / 28983 HGNCID:24465 Length:423 Species:Homo sapiens


Alignment Length:247 Identity:76/247 - (30%)
Similarity:112/247 - (45%) Gaps:38/247 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 RIINGTTVDIARHPYLVSLRYRRDNESSYMHECAGVIISEQALITSAQCLYGLPEETKLVAVAG- 88
            ||:.||.|:....|:..||::    :.|  |.|...:|:...|:::|.|........:..|..| 
Human   191 RIVGGTEVEEGEWPWQASLQW----DGS--HRCGATLINATWLVSAAHCFTTYKNPARWTASFGV 249

  Fly    89 ----ANTRNGTDGFIYPVANWTHHPNYDPVTVDNDIGVLLLDTTLDLT------LLGISSIGIRP 143
                :..:.|....|.       |..|...:.|.||.:..|.:.:..|      .|..:|...:|
Human   250 TIKPSKMKRGLRRIIV-------HEKYKHPSHDYDISLAELSSPVPYTNAVHRVCLPDASYEFQP 307

  Fly   144 ERPAVGRLATVAGWGYREEWGPSSYKLEQTEVPVVSSEQCT--QIYGAGEVTERMICAGFVVQGG 206
                 |.:..|.|:|..:..|.|...|.|.:|.::.:..|.  |.|. ..:|.||:||| .::|.
Human   308 -----GDVMFVTGFGALKNDGYSQNHLRQAQVTLIDATTCNEPQAYN-DAITPRMLCAG-SLEGK 365

  Fly   207 SDACQGDTGGPLVIDG-----QLVGLVSWGRGCARPNYPTVYCYVASFVDWI 253
            :||||||:|||||...     .|.|:||||..||:||.|.||..|.:..|||
Human   366 TDACQGDSGGPLVSSDARDIWYLAGIVSWGDECAKPNKPGVYTRVTALRDWI 417

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kappaTryNP_610674.5 Tryp_SPc 25..253 CDD:214473 74/245 (30%)
Tryp_SPc 26..256 CDD:238113 75/246 (30%)
TMPRSS11ENP_054777.2 SEA 51..156 CDD:307516
Tryp_SPc 192..420 CDD:238113 75/246 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.