DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kappaTry and KLK9

DIOPT Version :9

Sequence 1:NP_610674.5 Gene:kappaTry / 36215 FlyBaseID:FBgn0043471 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_036447.1 Gene:KLK9 / 284366 HGNCID:6370 Length:250 Species:Homo sapiens


Alignment Length:218 Identity:65/218 - (29%)
Similarity:104/218 - (47%) Gaps:38/218 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 CAGVIISEQALITSAQC----LYGLPEETKLVAVAGANTRNGTDGFIYPVANWTHHP--NYDPVT 115
            |...:||::.|:|:|.|    |:....|..|....|...       ::.|.::..||  |.|...
Human    48 CGATLISDRWLLTAAHCRKPYLWVRLGEHHLWKWEGPEQ-------LFRVTDFFPHPGFNKDLSA 105

  Fly   116 VDNDIGVLLLDTTLDLTL------LGISSIGIRPERPAVGRLATVAGWGYREEWGPSSYK----- 169
            .|::..::|:.......|      |.:|...:.|     |....::|||     ..||.|     
Human   106 NDHNDDIMLIRLPRQARLSPAVQPLNLSQTCVSP-----GMQCLISGWG-----AVSSPKALFPV 160

  Fly   170 -LEQTEVPVVSSEQCTQIYGAGEVTERMICAGFVVQGGSDACQGDTGGPLVIDGQLVGLVSWG-R 232
             |:...:.::.::.|...| .|.:::.|:||| :.:||..:||||:|||||.:|.|.|:||.| .
Human   161 TLQCANISILENKLCHWAY-PGHISDSMLCAG-LWEGGRGSCQGDSGGPLVCNGTLAGVVSGGAE 223

  Fly   233 GCARPNYPTVYCYVASFVDWIEE 255
            .|:||..|.||..|..::|||:|
Human   224 PCSRPRRPAVYTSVCHYLDWIQE 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kappaTryNP_610674.5 Tryp_SPc 25..253 CDD:214473 62/214 (29%)
Tryp_SPc 26..256 CDD:238113 65/218 (30%)
KLK9NP_036447.1 Tryp_SPc 24..247 CDD:238113 65/218 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.