DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kappaTry and Tmprss5

DIOPT Version :9

Sequence 1:NP_610674.5 Gene:kappaTry / 36215 FlyBaseID:FBgn0043471 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_695223.2 Gene:Tmprss5 / 266681 RGDID:628625 Length:445 Species:Rattus norvegicus


Alignment Length:252 Identity:83/252 - (32%)
Similarity:124/252 - (49%) Gaps:35/252 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 RIINGTTVDIARHPYLVSLRYRRDNESSYMHECAGVIISEQALITSAQCLYGL--------PEET 81
            ||:.|..|...|.|:..|:..      ...|.|...:::...::|:|.|:|..        ....
  Rat   207 RIVGGQAVASGRWPWQASVML------GSRHTCGASVLAPYWVVTAAHCMYSFRLSRLSSWRVHA 265

  Fly    82 KLVAVAGANTRNGTDGFIYPVANWTHHPNYDPVTVDNDIGVLLLDTTLDLT-LLGISSIGIRPER 145
            .||:.:......||     .|.....||.|.....|.|:.:|.|.|.::.: .:....:..:.:.
  Rat   266 GLVSHSAVRQHQGT-----MVEKIIPHPLYSAQNHDYDVALLQLRTPINFSDTVSAVCLPAKEQH 325

  Fly   146 PAVGRLATVAGWGYREEWGP----SSYKLEQTEVPVVSSEQCTQ--IYGAGEVTERMICAGFVVQ 204
            ...|....|:|||:.:   |    ||..|:.|.||::|::.|..  :| :|.:|.||:|||: :.
  Rat   326 FPQGSQCWVSGWGHTD---PSHTHSSDTLQDTMVPLLSTDLCNSSCMY-SGALTHRMLCAGY-LD 385

  Fly   205 GGSDACQGDTGGPLVIDG----QLVGLVSWGRGCARPNYPTVYCYVASFVDWIEETI 257
            |.:||||||:|||||...    .|||:||||||||.||.|.||..||.|:|||.:|:
  Rat   386 GRADACQGDSGGPLVCPSGDTWHLVGVVSWGRGCAEPNRPGVYAKVAEFLDWIHDTV 442

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kappaTryNP_610674.5 Tryp_SPc 25..253 CDD:214473 80/246 (33%)
Tryp_SPc 26..256 CDD:238113 81/248 (33%)
Tmprss5NP_695223.2 SRCR_2 106..203 CDD:406055
Tryp_SPc 208..441 CDD:238113 81/248 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.