DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kappaTry and KLK5

DIOPT Version :9

Sequence 1:NP_610674.5 Gene:kappaTry / 36215 FlyBaseID:FBgn0043471 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_001070959.1 Gene:KLK5 / 25818 HGNCID:6366 Length:293 Species:Homo sapiens


Alignment Length:259 Identity:82/259 - (31%)
Similarity:118/259 - (45%) Gaps:45/259 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 SGQPEGRIINGTTVDIARHPYLVSLRYRRDNESSYMHECAGVIISEQALITSAQCL--------- 74
            |.....|||||:..|:...|:..:|..|.:  ..|   |..|::..|.|:|:|.|.         
Human    60 SDDSSSRIINGSDCDMHTQPWQAALLLRPN--QLY---CGAVLVHPQWLLTAAHCRKKVFRVRLG 119

  Fly    75 -YGLPEETKLVAVAGANTRNGTDGFIYPVANWTHHPNYDPVTVDNDIGVLLLD----TTLDLTLL 134
             |.|..    |..:|.....|....        .||.|......||:.::.|:    .|.|:..:
Human   120 HYSLSP----VYESGQQMFQGVKSI--------PHPGYSHPGHSNDLMLIKLNRRIRPTKDVRPI 172

  Fly   135 GISSIGIRPERPAVGRLATVAGWGYREEWGPSSY---KLEQTEVPVVSSEQCTQIYGAGEVTERM 196
            .:||     ..|:.|....|:|||..:  .|..:   .|:...:.|:|.::|...| ..::.:.|
Human   173 NVSS-----HCPSAGTKCLVSGWGTTK--SPQVHFPKVLQCLNISVLSQKRCEDAY-PRQIDDTM 229

  Fly   197 ICAGFVVQGGSDACQGDTGGPLVIDGQLVGLVSWG-RGCARPNYPTVYCYVASFVDWIEETIAA 259
            .|||  .:.|.|:||||:|||:|.:|.|.|||||| ..|||||.|.||..:..|..||:|||.|
Human   230 FCAG--DKAGRDSCQGDSGGPVVCNGSLQGLVSWGDYPCARPNRPGVYTNLCKFTKWIQETIQA 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kappaTryNP_610674.5 Tryp_SPc 25..253 CDD:214473 75/245 (31%)
Tryp_SPc 26..256 CDD:238113 76/247 (31%)
KLK5NP_001070959.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 37..68 2/7 (29%)
Tryp_SPc 66..285 CDD:214473 75/245 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.