DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kappaTry and Klk1b4

DIOPT Version :9

Sequence 1:NP_610674.5 Gene:kappaTry / 36215 FlyBaseID:FBgn0043471 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_035045.2 Gene:Klk1b4 / 18048 MGIID:97320 Length:256 Species:Mus musculus


Alignment Length:228 Identity:66/228 - (28%)
Similarity:107/228 - (46%) Gaps:41/228 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 HECAGVIISEQALITSAQCLYGLPEETKLVAVAGANTRNGTDGFIYPVANWTH--------HPNY 111
            ::|.||::....::|:|.| |....:..|          |.:.|:....:..|        ||::
Mouse    43 YQCGGVLLDRNWVLTAAHC-YNDKYQVWL----------GKNNFLEDEPSDQHRLVSKAIPHPDF 96

  Fly   112 D--------PVTVD---NDIGVLLLDTTLDLTLLGISSIGIRPERPAVGRLATVAGWGYREEWGP 165
            :        |...|   ||:.:|.|....|:|.: :..|.:..|.|.:|.....:|||   ...|
Mouse    97 NMSLLNEHTPQPEDDYSNDLMLLRLSKPADITDV-VKPITLPTEEPKLGSTCLASGWG---STTP 157

  Fly   166 SSYK----LEQTEVPVVSSEQCTQIYGAGEVTERMICAGFVVQGGSDACQGDTGGPLVIDGQLVG 226
            ..:|    |:...:.::.:|.|.:.:.. :||:.|:||| .:.|||..|:.|:||||:.||.|.|
Mouse   158 IKFKYPDDLQCVNLKLLPNEDCDKAHEM-KVTDAMLCAG-EMDGGSYTCEHDSGGPLICDGILQG 220

  Fly   227 LVSWG-RGCARPNYPTVYCYVASFVDWIEETIA 258
            :.||| ..|..|..|:||..:..|..||.||:|
Mouse   221 ITSWGPEPCGEPTEPSVYTKLIKFSSWIRETMA 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kappaTryNP_610674.5 Tryp_SPc 25..253 CDD:214473 61/221 (28%)
Tryp_SPc 26..256 CDD:238113 63/224 (28%)
Klk1b4NP_035045.2 Tryp_SPc 13..251 CDD:238113 63/224 (28%)
Activation peptide homolog 18..24
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.