DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kappaTry and Klk1b27

DIOPT Version :9

Sequence 1:NP_610674.5 Gene:kappaTry / 36215 FlyBaseID:FBgn0043471 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_064664.1 Gene:Klk1b27 / 16619 MGIID:891980 Length:263 Species:Mus musculus


Alignment Length:274 Identity:82/274 - (29%)
Similarity:129/274 - (47%) Gaps:38/274 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LLLLAIGFSSVISISGQP--EGRIINGTTVDIARHPYLVSLRYRRDNESSYMHECAGVIISEQAL 67
            :|.||:   |:..|...|  :.|||.|........|:.|::  .|.|:    :.|.||::....:
Mouse     5 ILFLAL---SLGGIDAAPPVQSRIIGGFKCKKNSQPWHVAV--LRSNK----YICGGVLLDPNWV 60

  Fly    68 ITSAQCLYG---------LPEETKLVAVAGANTRNGTDGFIYPVANWT----HHPNYDPVTVDND 119
            :|:|.| ||         |.:.........|..|..:..|.:|..|.:    |.|:  |....||
Mouse    61 LTAAHC-YGNDTSQHNVWLGKNKLFQREPSAQHRWVSKSFPHPDYNMSLLNDHIPH--PEDKSND 122

  Fly   120 IGVLLLDTTLDLTLLGISSIGIRPERPAVGRLATVAGWGYREEWGPSSYK----LEQTEVPVVSS 180
            :.:|.|....|:| ..:..|.:..|.|.:|.....:|||   ...|:.|:    |:...:.::.:
Mouse   123 LMLLRLSKPADIT-DAVKPIDLPTEEPKLGSTCLASGWG---SITPTKYQIPNDLQCVFIKLLPN 183

  Fly   181 EQCTQIYGAGEVTERMICAGFVVQGGSDACQGDTGGPLVIDGQLVGLVSWGR-GCARPNYPTVYC 244
            |.|.:.| ..:||:.|:|.| ...||...|:||:||||:.||.|.|:.|||. .||:||.|.|:.
Mouse   184 ENCAKAY-VHKVTDVMLCVG-ETGGGKGTCKGDSGGPLICDGVLHGITSWGSIPCAKPNAPGVFT 246

  Fly   245 YVASFVDWIEETIA 258
            .:..|..||::|:|
Mouse   247 KLIKFTSWIKDTMA 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kappaTryNP_610674.5 Tryp_SPc 25..253 CDD:214473 72/245 (29%)
Tryp_SPc 26..256 CDD:238113 73/247 (30%)
Klk1b27NP_064664.1 Tryp_SPc 24..255 CDD:214473 72/245 (29%)
Tryp_SPc 25..258 CDD:238113 73/247 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.