DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kappaTry and Klk9

DIOPT Version :9

Sequence 1:NP_610674.5 Gene:kappaTry / 36215 FlyBaseID:FBgn0043471 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_082936.2 Gene:Klk9 / 101533 MGIID:1921082 Length:251 Species:Mus musculus


Alignment Length:227 Identity:70/227 - (30%)
Similarity:108/227 - (47%) Gaps:52/227 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 CAGVIISEQALITSAQC---------------LYGLPEETKLVAVAGANTRNGTDGFIYPVANWT 106
            |...:|::|.|:|:|.|               .:..||:..||          ||.|        
Mouse    48 CGATLINDQWLLTAAHCRKPYLWVRLGEHHLWRWEGPEQLLLV----------TDFF-------- 94

  Fly   107 HHPNYDPVTVDN----DIGVLLLDTTLDLTLLGISSIGIRPERPAVGRLATVAGWGYREEWGPSS 167
            .||.::|....|    ||.::.|...:.|| ..:..:.:...||.||....::|||     ..||
Mouse    95 PHPGFNPDLSANDHNDDIMLIRLPRKVRLT-PAVQPLNLTESRPPVGTQCLISGWG-----SVSS 153

  Fly   168 YKLEQ------TEVPVVSSEQCTQIYGAGEVTERMICAGFVVQGGSDACQGDTGGPLVIDGQLVG 226
            .||:.      ..:.::.::.|...| .|.::|:|:||| :.:||..:||||:|||||.:|.|.|
Mouse   154 SKLQYPMTLQCANISILDNKLCRWAY-PGHISEKMLCAG-LWEGGRGSCQGDSGGPLVCEGTLAG 216

  Fly   227 LVSWG-RGCARPNYPTVYCYVASFVDWIEETI 257
            :||.| ..|:||..|.||..|..:::|||.|:
Mouse   217 IVSGGSEPCSRPRRPAVYTNVFDYLEWIESTM 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kappaTryNP_610674.5 Tryp_SPc 25..253 CDD:214473 66/221 (30%)
Tryp_SPc 26..256 CDD:238113 69/224 (31%)
Klk9NP_082936.2 Tryp_SPc 24..247 CDD:238113 69/224 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.