DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kappaTry and tmprss9

DIOPT Version :9

Sequence 1:NP_610674.5 Gene:kappaTry / 36215 FlyBaseID:FBgn0043471 Length:263 Species:Drosophila melanogaster
Sequence 2:XP_002940084.3 Gene:tmprss9 / 100489279 XenbaseID:XB-GENE-993973 Length:1151 Species:Xenopus tropicalis


Alignment Length:260 Identity:89/260 - (34%)
Similarity:135/260 - (51%) Gaps:32/260 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 GFSSVISISGQPEGRIINGTTVDIARHPYLVSLRYRRDNESSYMHECAGVIISEQALITSAQCLY 75
            ||:.|:     |..:|:.|:.......|:.|||..||..     |:|..|:||::.|:::|.| :
 Frog   909 GFAPVL-----PFNKIVGGSGSVRGEWPWQVSLWLRRKE-----HKCGAVLISDRWLLSAAHC-F 962

  Fly    76 GLPEETKL-VAVAGANTRNGTDGFIYPVANWTHHPNYDPVTVDNDIGVLLLDTTLDLTLLGISSI 139
            .:..:.|| .|..|....||.:|.:..:.....||.|:..|:|||:.:|.|.:.|..|.|     
 Frog   963 DIYSDPKLWAAYLGTPFLNGVEGRVEKIFRIHKHPFYNVYTLDNDVALLELPSPLTYTNL----- 1022

  Fly   140 GIRPE-RPAV------GRLATVAGWGYREEWGPSSYKLEQTEVPVVSSEQCTQIYGAGEVTERMI 197
             |||. .|.:      |....:.|||..:|.|..|.:|::..|.:|..:.|.:.|.. :::.||:
 Frog  1023 -IRPICLPDISHIFPEGTRCFITGWGSTKEGGAMSRQLQKASVSIVGDQTCKKFYPI-QISPRML 1085

  Fly   198 CAGFVVQGGSDACQGDTGGPLVI---DGQ--LVGLVSWGRGCARPNYPTVYCYVASFVDWIEETI 257
            |||| :|||.|:|.||.||||..   .|:  |.|:.|||.|||||.:|.||..:.|..:||.:.:
 Frog  1086 CAGF-MQGGVDSCSGDAGGPLACREPSGRWFLAGITSWGYGCARPYFPGVYTRITSVRNWIGQNL 1149

  Fly   258  257
             Frog  1150  1149

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kappaTryNP_610674.5 Tryp_SPc 25..253 CDD:214473 83/240 (35%)
Tryp_SPc 26..256 CDD:238113 85/242 (35%)
tmprss9XP_002940084.3 SEA 60..156 CDD:396113
LDLa 186..221 CDD:238060
Tryp_SPc 234..463 CDD:214473
Tryp_SPc 547..774 CDD:238113
LDLa 871..906 CDD:238060
Tryp_SPc 919..1145 CDD:238113 83/239 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.