DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kappaTry and tmprss11f

DIOPT Version :9

Sequence 1:NP_610674.5 Gene:kappaTry / 36215 FlyBaseID:FBgn0043471 Length:263 Species:Drosophila melanogaster
Sequence 2:XP_004911133.1 Gene:tmprss11f / 100379970 XenbaseID:XB-GENE-1012399 Length:427 Species:Xenopus tropicalis


Alignment Length:257 Identity:83/257 - (32%)
Similarity:120/257 - (46%) Gaps:36/257 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 IGFSSVISISGQPEGRIINGTTVDIARHPYLVSLRYRRDNESSYMHECAGVIISEQALITSAQCL 74
            ||..||       ..||:.||...:...|:..|||....      |.|...::::..|:.:|.|.
 Frog   188 IGGPSV-------SNRIVGGTNAGLGSWPWQASLRLLGS------HTCGASLLNDTWLVAAAHCF 239

  Fly    75 YGLPEETKLVAVAGANTRNGTDGFIYPVANWTHHPNYDPVTVDNDIGVLLLDTTLDLTLLGISSI 139
            ....:......|.|  |.|...|..:.:.....:..|......|||.:|.|.|.|:.|.:     
 Frog   240 DMNADANSWTVVLG--TINVYSGSEFKIEKIIIYEGYTSHNHRNDIALLKLFTPLNFTSI----- 297

  Fly   140 GIR----PERPAV---GRLATVAGWGYREEWGPSSYKLEQTEVPVVSSEQC--TQIYGAGEVTER 195
             ||    ||...:   |....:.|||...:.|.:|..|:|.||.:::|:.|  :|:|| |.:...
 Frog   298 -IRPVCLPEASDIFPDGSSCYITGWGALTDGGSASQVLQQAEVKIINSDTCSSSQMYG-GLIYPS 360

  Fly   196 MICAGFVVQGGSDACQGDTGGPLVI--DGQ--LVGLVSWGRGCARPNYPTVYCYVASFVDWI 253
            |||||:.. |..|:||||:|||||.  .|:  |:|:||:|.|||.||.|.||..:....:||
 Frog   361 MICAGYAT-GQIDSCQGDSGGPLVTLKSGRWVLIGIVSFGYGCALPNKPGVYSRITYLRNWI 421

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kappaTryNP_610674.5 Tryp_SPc 25..253 CDD:214473 77/240 (32%)
Tryp_SPc 26..256 CDD:238113 78/241 (32%)
tmprss11fXP_004911133.1 SEA 48..148 CDD:396113
Tryp_SPc 197..421 CDD:238113 76/239 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.