DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lambdaTry and prss60.1

DIOPT Version :9

Sequence 1:NP_610673.1 Gene:lambdaTry / 36214 FlyBaseID:FBgn0043470 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_001082915.1 Gene:prss60.1 / 799770 ZFINID:ZDB-GENE-070424-25 Length:387 Species:Danio rerio


Alignment Length:261 Identity:89/261 - (34%)
Similarity:128/261 - (49%) Gaps:40/261 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 CSLADPIYRNEEVHIPKLDGRIVGGQDTNITQYPHQISMR--YRGNHRCGGTIYRSNQIISAAHC 77
            |.||            .|:.|||||.:.....:|.|:|:.  ..|.|.|||::..|..:::||||
Zfish    25 CGLA------------PLNNRIVGGVNAFDGSWPWQVSLHSPIYGGHFCGGSLINSEWVLTAAHC 77

  Fly    78 VNTLSGPENLTIVAGSSNIWFPTGPQQELEVRE-------IIIHPKYRTLNNDYDAAILILDGDF 135
            :..:: ..:|.:..|.:.       ||.:...|       |.:||.|..|.|:.|.|:|.|....
Zfish    78 LPRIT-TSSLLVFLGKTT-------QQGVNTYEINRTVSVITVHPSYNNLTNENDIALLHLSSAV 134

  Fly   136 EFNDAVQPIELAKERP--DHDTPVTVTGWGTTSEGGTI--SDVLQEVSVNVVDNSNCKNAY--SI 194
            .|::.::|:.||.:..  .:.|...:||||....|..:  ..:|||..:.||.|..| ||.  |.
Zfish   135 TFSNYIRPVCLAAQNSVFPNGTSSWITGWGNIQLGVNLPAPGILQETMIPVVPNDQC-NALLGSG 198

  Fly   195 MLTSRMLCAGVNGGGKDACQGDSGGPLVYNNTLL----GIVSWGTGCAREKYPGVYCSVPDVLDW 255
            .:|:.|:|||:..||:|.||||||||:|....|:    ||.|||.|||....||||..|.....|
Zfish   199 SVTNNMICAGLLQGGRDTCQGDSGGPMVSKQCLVWVQSGITSWGYGCADPYSPGVYTRVSQYQSW 263

  Fly   256 L 256
            :
Zfish   264 I 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lambdaTryNP_610673.1 Tryp_SPc 35..255 CDD:214473 84/238 (35%)
Tryp_SPc 36..259 CDD:238113 84/240 (35%)
prss60.1NP_001082915.1 Tryp_SPc 33..264 CDD:214473 84/239 (35%)
Tryp_SPc 34..267 CDD:238113 84/240 (35%)
Somatomedin_B 349..382 CDD:295334
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.