DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lambdaTry and st14b

DIOPT Version :9

Sequence 1:NP_610673.1 Gene:lambdaTry / 36214 FlyBaseID:FBgn0043470 Length:272 Species:Drosophila melanogaster
Sequence 2:XP_005161261.1 Gene:st14b / 777629 ZFINID:ZDB-GENE-061103-613 Length:864 Species:Danio rerio


Alignment Length:246 Identity:90/246 - (36%)
Similarity:127/246 - (51%) Gaps:21/246 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 PKLDGRIVGGQDTNITQYPHQIS--MRYRGNHRCGGTIYRSNQIISAAHCVN-----TLSGPENL 87
            |....|||||:|::..::|.|:|  |:.:| |.||.::..::.:::|||||.     ..|..:..
Zfish   619 PHKSSRIVGGKDSDEGEWPWQVSLHMKTQG-HVCGASVISNSWLVTAAHCVQDNDQFRYSQADQW 682

  Fly    88 TIVAGSSNIWFPTGPQQELEVREIIIHPKYRTLNNDYDAAILILDGDFEFNDAVQPIELAKERPD 152
            .:..|..| ...|....:..|..||.||:|...:.|.|.|::.||.....|..:.||.|..  |.
Zfish   683 EVYLGLHN-QGETSKSTQRSVLRIIPHPQYDHSSYDNDIALMELDSPVTLNQNIWPICLPD--PT 744

  Fly   153 HDTP----VTVTGWGTTSEGG-TISDVLQEVSVNVVDNSNCKNAYSIMLTSRMLCAGVNGGGKDA 212
            |..|    |.:||||...||. .:..|||:..|.:::::.|.......:|..|:||||..||.||
Zfish   745 HYFPAGKSVWITGWGKLREGSDAVPSVLQKAEVRIINSTVCSKLMDDGITPHMICAGVLSGGVDA 809

  Fly   213 CQGDSGGPL--VYNN---TLLGIVSWGTGCAREKYPGVYCSVPDVLDWLVE 258
            ||||||||:  :..|   .|.|:||||.||.|...||||..|.|...|:.|
Zfish   810 CQGDSGGPMSSIEGNGRMFLAGVVSWGDGCGRRNRPGVYTRVTDYRSWIRE 860

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lambdaTryNP_610673.1 Tryp_SPc 35..255 CDD:214473 87/236 (37%)
Tryp_SPc 36..259 CDD:238113 88/240 (37%)
st14bXP_005161261.1 SEA 92..180 CDD:279699
CUB 233..342 CDD:238001
CUB 351..457 CDD:238001
LDLa 465..497 CDD:238060
LDLa 499..533 CDD:238060
LDLa 536..570 CDD:238060
LDLa 578..613 CDD:238060
Tryp_SPc 624..858 CDD:214473 87/237 (37%)
Tryp_SPc 625..861 CDD:238113 88/240 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.