DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lambdaTry and Prss36

DIOPT Version :9

Sequence 1:NP_610673.1 Gene:lambdaTry / 36214 FlyBaseID:FBgn0043470 Length:272 Species:Drosophila melanogaster
Sequence 2:XP_017167884.1 Gene:Prss36 / 77613 MGIID:1924863 Length:863 Species:Mus musculus


Alignment Length:257 Identity:88/257 - (34%)
Similarity:124/257 - (48%) Gaps:25/257 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 PKLDGRIVGGQDTNITQYPHQISMRYRGNHRCGGTIYRSNQIISAAHCV---NTLSGPENLTIVA 91
            |:...|||||.|.:...:|.|:|:...|.|.|||::...:.::|||||.   .||...:.|:::.
Mouse    42 PEPSSRIVGGSDAHPGTWPWQVSLHQGGGHICGGSLIAPSWVLSAAHCFVTNGTLEPADELSVLL 106

  Fly    92 GSSNIWFPTGPQQELEVRE---IIIHPKYRTLNNDYDAAILILDGDFEFNDAVQPIEL--AKERP 151
            |   :....||.:...:|.   |:|...|.|:....|.|:|.|....:...:|:|:.|  |....
Mouse   107 G---VHSQDGPLEGAHMRSVATILIPDNYSTVELGADLALLRLASPAKLGPSVRPVCLPRASHLF 168

  Fly   152 DHDTPVTVTGWGTTSEGG--TISDVLQEVSVNVVDNSNCKNAYS--------IMLTSRMLCAGVN 206
            .|.|....||||...|..  .:..|||||.:.::..:.|:..||        ..|...|||||..
Mouse   169 AHGTACWATGWGDVQEAVPLPLPWVLQEVELRLLGEAACQCLYSRPGPFNLTFQLLPGMLCAGYP 233

  Fly   207 GGGKDACQGDSGGPLVYNN----TLLGIVSWGTGCAREKYPGVYCSVPDVLDWLVETVADKE 264
            .|.:|.||||||||||..:    .|.||.|:|.||.|...|||:.:|.....|:.|.|...|
Mouse   234 AGRRDTCQGDSGGPLVCEDGGRWFLAGITSFGFGCGRRNRPGVFTAVAPYESWIREHVMGSE 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lambdaTryNP_610673.1 Tryp_SPc 35..255 CDD:214473 83/241 (34%)
Tryp_SPc 36..259 CDD:238113 83/244 (34%)
Prss36XP_017167884.1 Tryp_SPc 48..290 CDD:238113 83/244 (34%)
Tryp_SPc 331..532 CDD:389826
Tryp_SPc 607..789 CDD:389826
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167839477
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100031
Panther 1 1.100 - - O PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.