DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lambdaTry and C1S

DIOPT Version :9

Sequence 1:NP_610673.1 Gene:lambdaTry / 36214 FlyBaseID:FBgn0043470 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_001725.1 Gene:C1S / 716 HGNCID:1247 Length:688 Species:Homo sapiens


Alignment Length:259 Identity:69/259 - (26%)
Similarity:113/259 - (43%) Gaps:39/259 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 RIVGGQDTNITQYPHQISMRYRGNHRCGGTIYRSNQIISAAHCVNTLSGPENLTIVAGSSNIWFP 99
            ||:||.|.:|..:|.|:   :..|...||.:.....:::|||.|   .|....|:..||:::...
Human   437 RIIGGSDADIKNFPWQV---FFDNPWAGGALINEYWVLTAAHVV---EGNREPTMYVGSTSVQTS 495

  Fly   100 -TGPQQELEVREIIIHPKYRTL-------NNDYDAAILILDGDFEFNDAVQPIELAKERPDHDTP 156
             ....:.|....:.|||.::.|       |.|.|.|::.|....:....|.||.|.....|::..
Human   496 RLAKSKMLTPEHVFIHPGWKLLEVPEGRTNFDNDIALVRLKDPVKMGPTVSPICLPGTSSDYNLM 560

  Fly   157 ----VTVTGWGTTSEGGTISDVLQEVSVNVVDNSNCK---------NAYSIMLTSRMLCAGVNGG 208
                ..::|||.| |....:..|:...:.|.....||         :|.:.:.|..|:||| ...
Human   561 DGDLGLISGWGRT-EKRDRAVRLKAARLPVAPLRKCKEVKVEKPTADAEAYVFTPNMICAG-GEK 623

  Fly   209 GKDACQGDSGGPLVYNNT-------LLGIVSWGTGCAREKYPGVYCSVPDVLDWLVETVADKES 265
            |.|:|:|||||.....:.       ..|:||||..|...   |:|..|.:.:||:::|:.:..:
Human   624 GMDSCKGDSGGAFAVQDPNDKTKFYAAGLVSWGPQCGTY---GLYTRVKNYVDWIMKTMQENST 684

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lambdaTryNP_610673.1 Tryp_SPc 35..255 CDD:214473 66/247 (27%)
Tryp_SPc 36..259 CDD:238113 67/250 (27%)
C1SNP_001725.1 CUB 18..129 CDD:238001
FXa_inhibition 143..171 CDD:405372
CUB 175..287 CDD:395345
CCP 294..355 CDD:153056
Sushi 359..421 CDD:395037
Tryp_SPc 438..678 CDD:238113 67/250 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.