DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lambdaTry and C1R

DIOPT Version :9

Sequence 1:NP_610673.1 Gene:lambdaTry / 36214 FlyBaseID:FBgn0043470 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_001341275.1 Gene:C1R / 715 HGNCID:1246 Length:719 Species:Homo sapiens


Alignment Length:302 Identity:88/302 - (29%)
Similarity:131/302 - (43%) Gaps:70/302 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 GVGCSLADPIYRNEE--VHIPKL-------------DGRIVGGQDTNITQYPHQISMRYRGNHRC 61
            ||....|..|::||:  ..||:.             ..||:|||...:..:|.|:.....|  |.
Human   439 GVYTCTAQGIWKNEQKGEKIPRCLPVCGKPVNPVEQRQRIIGGQKAKMGNFPWQVFTNIHG--RG 501

  Fly    62 GGTIYRSNQIISAAHCVNTLSGPE-------NLTIVAGSSNIWFPTGPQQEL------EVREIII 113
            ||.:.....|::|||   ||...|       :|.:..|.:|:       :||      .:|.:.:
Human   502 GGALLGDRWILTAAH---TLYPKEHEAQSNASLDVFLGHTNV-------EELMKLGNHPIRRVSV 556

  Fly   114 HPKYR---TLNNDYDAAILILDGDFEFNDAVQPIELAKERPDHDTPVT------VTGWGTTSEGG 169
            ||.||   :.|.:.|.|:|.|:........:.||.|    ||:||...      |:|:|...|  
Human   557 HPDYRQDESYNFEGDIALLELENSVTLGPNLLPICL----PDNDTFYDLGLMGYVSGFGVMEE-- 615

  Fly   170 TISDVLQEVSVNVVDNSNC------KNAYSIMLTSRMLCAGVNGGGKDACQGDSGGPLVYN--NT 226
            .|:..|:.|.:.|.:...|      ||...: .:..|.|||.....:|||||||||.....  ||
Human   616 KIAHDLRFVRLPVANPQACENWLRGKNRMDV-FSQNMFCAGHPSLKQDACQGDSGGVFAVRDPNT 679

  Fly   227 ----LLGIVSWGTGCAREKYPGVYCSVPDVLDWLVETVADKE 264
                ..||||||.||:|..  |.|..|.:.:||:.:.:.:::
Human   680 DRWVATGIVSWGIGCSRGY--GFYTKVLNYVDWIKKEMEEED 719

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lambdaTryNP_610673.1 Tryp_SPc 35..255 CDD:214473 78/253 (31%)
Tryp_SPc 36..259 CDD:238113 79/256 (31%)
C1RNP_001341275.1 CUB 41..152 CDD:214483
FXa_inhibition 175..203 CDD:317114
CUB 207..316 CDD:278839
Sushi 323..385 CDD:306569
Sushi 390..461 CDD:306569 8/21 (38%)
Tryp_SPc 477..711 CDD:214473 79/254 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.