DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lambdaTry and Prss32

DIOPT Version :9

Sequence 1:NP_610673.1 Gene:lambdaTry / 36214 FlyBaseID:FBgn0043470 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_081496.2 Gene:Prss32 / 69814 MGIID:1917064 Length:334 Species:Mus musculus


Alignment Length:249 Identity:90/249 - (36%)
Similarity:130/249 - (52%) Gaps:18/249 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 PKLDGRIVGGQDTNITQYPHQISMRYRGNHRCGGTIYRSNQIISAAHCVNTLSGPENLTIVAGSS 94
            |:..||||.|||..:.::|.|:|:|..|.|.|||::...:.:::||||.|........|::.|:.
Mouse    48 PRTSGRIVSGQDAQLGRWPWQVSVRENGAHVCGGSLIAEDWVLTAAHCFNQGQSLSIYTVLLGTI 112

  Fly    95 NIWFPTGPQQELE-VREIIIHPKYRT-LNNDYDAAILILDGDFEFNDAVQPIELAK--ERPDHDT 155
            :.:......:||. |.:.|.||.|.. .::..|.|::.|.....|||.:.|:.|.|  :..|..|
Mouse   113 SSYPEDNEPKELRAVAQFIKHPSYSADEHSSGDIALVQLASPISFNDYMLPVCLPKPGDPLDPGT 177

  Fly   156 PVTVTGWGTTSEGGTISD--VLQEVSVNVVDNSNCKNAY---SI-----MLTSRMLCAGVNGGGK 210
            ...|||||.......:..  .|||:.|.::|...|...|   ||     ::...|||||...|.|
Mouse   178 MCWVTGWGHIGTNQPLPPPFTLQELQVPLIDAETCNTYYQENSIPGTEPVILEGMLCAGFQEGKK 242

  Fly   211 DACQGDSGGPLV--YNNTLL--GIVSWGTGCAREKYPGVYCSVPDVLDWLVETV 260
            |||.||||||||  .|:..:  |:||||:.||..|.||||.:|...:.|:..|:
Mouse   243 DACNGDSGGPLVCDINDVWIQAGVVSWGSDCALFKRPGVYTNVSVYISWIQNTM 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lambdaTryNP_610673.1 Tryp_SPc 35..255 CDD:214473 86/237 (36%)
Tryp_SPc 36..259 CDD:238113 86/240 (36%)
Prss32NP_081496.2 Tryp_SPc 53..292 CDD:214473 86/238 (36%)
Tryp_SPc 54..295 CDD:238113 86/240 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.