DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lambdaTry and LOC683422

DIOPT Version :9

Sequence 1:NP_610673.1 Gene:lambdaTry / 36214 FlyBaseID:FBgn0043470 Length:272 Species:Drosophila melanogaster
Sequence 2:XP_006252253.1 Gene:LOC683422 / 683422 RGDID:1586868 Length:312 Species:Rattus norvegicus


Alignment Length:239 Identity:88/239 - (36%)
Similarity:126/239 - (52%) Gaps:20/239 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 IVGGQDTNITQYPHQISMRYRGNHRCGGTIYRSNQIISAAHCVNTLSGPENLTIVAGSSNIWFPT 100
            |:||:..||::.|..:.:...|.|.|||:|.....::||:||.:.::. .||.|..|..::  .|
  Rat    46 IMGGKPANISEVPWHVGIMNHGTHLCGGSILNEWWVLSASHCFDQINN-ANLEIRHGRDDL--ST 107

  Fly   101 GPQQELEVREIIIHPKYRTLNNDYDAAILILDGDFEFNDAVQPI---ELAKERPDHDTPVTVTGW 162
            ...:..:|.::|:|||:.....|.|.|:|:|......:....||   ||:..|...:  ..||||
  Rat   108 KNVKHEKVDKLILHPKFDDWLLDNDIALLLLKSPLNLSINGIPICTSELSDLRIWKN--CWVTGW 170

  Fly   163 GTTSEGG--TISDVLQEVSVNVVDNSNCKNAYSI-MLTSRMLCAGVNGGGKDACQGDSGGPLVYN 224
            |.|:..|  ..:..||:|.|::.....|  .|.: :||..|||||...||.|||||||||.||.|
  Rat   171 GITNVSGVKVQTTKLQKVQVDLFRWDWC--GYVLPLLTKNMLCAGTPDGGMDACQGDSGGALVCN 233

  Fly   225 -----NT--LLGIVSWGTGCAREKYPGVYCSVPDVLDWLVETVA 261
                 ||  .:||||||.||.::..||||..|...|.|:.:..|
  Rat   234 KKRNINTWYQVGIVSWGVGCGKKNLPGVYTKVSPYLKWIRKQTA 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lambdaTryNP_610673.1 Tryp_SPc 35..255 CDD:214473 86/231 (37%)
Tryp_SPc 36..259 CDD:238113 87/235 (37%)
LOC683422XP_006252253.1 Tryp_SPc 46..275 CDD:238113 87/235 (37%)
Tryp_SPc 46..272 CDD:214473 86/232 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.