DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lambdaTry and st14a

DIOPT Version :9

Sequence 1:NP_610673.1 Gene:lambdaTry / 36214 FlyBaseID:FBgn0043470 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_001035441.2 Gene:st14a / 678603 ZFINID:ZDB-GENE-030131-6496 Length:834 Species:Danio rerio


Alignment Length:270 Identity:93/270 - (34%)
Similarity:138/270 - (51%) Gaps:38/270 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 CSLADPIYRNEEVHIPKLDGRIVGGQDTNITQYPHQISMRYRG-NHRCGGTIYRSNQIISAAHCV 78
            |:.....|:.         .|||||||....::|.|:|:..:. .|.|||:|.....|::|||||
Zfish   585 CNCGTKAYKK---------SRIVGGQDAFEGEFPWQVSLHIKNIAHVCGGSIINERWIVTAAHCV 640

  Fly    79 NTLSGPENLTIVAGSSNIW--FPTGPQQELE--------VREIIIHPKYRTLNNDYDAAILILDG 133
            .     :::.|.......|  | .|...:.:        ::::|.||.|.....|.|.|::.::.
Zfish   641 Q-----DDVKIKYSQPGTWEVF-LGLHSQKDKLTATKRLLKQVIPHPYYNAYTYDNDIALMEMES 699

  Fly   134 DFEFNDAVQPIEL--AKERPDHDTPVTVTGWGTTSEGGTISDVLQEVSVNVVDNSNCKNAYSIML 196
            ...|:|.::|:.|  |.:.....|.|.::|||.|.|||:.:.|||:..|.:::::.|.......:
Zfish   700 PVTFSDTIRPVCLPTATDTFPAGTSVFISGWGATREGGSGATVLQKAEVRIINSTVCNQLMGGQI 764

  Fly   197 TSRMLCAGVNGGGKDACQGDSGGPLVYNN----TLLGIVSWGTGCAREKYPGVYCSVPDVLDWLV 257
            ||||.||||..||.|||||||||||.:.:    .|.|:||||.||||...||:|.:||....|: 
Zfish   765 TSRMTCAGVLSGGVDACQGDSGGPLSFPSGKRMFLAGVVSWGDGCARRNKPGIYSNVPKFRAWI- 828

  Fly   258 ETVADKESVG 267
                 ||..|
Zfish   829 -----KEKTG 833

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lambdaTryNP_610673.1 Tryp_SPc 35..255 CDD:214473 87/236 (37%)
Tryp_SPc 36..259 CDD:238113 87/239 (36%)
st14aNP_001035441.2 SEA 77..168 CDD:279699
CUB 219..322 CDD:238001
CUB 329..431 CDD:238001
LDLa 443..472 CDD:238060
LDLa 474..508 CDD:238060
LDLa 510..544 CDD:238060
LDLa 550..585 CDD:238060 93/270 (34%)
Tryp_SPc 596..828 CDD:214473 87/237 (37%)
Tryp_SPc 597..831 CDD:238113 88/245 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.