DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lambdaTry and f9b

DIOPT Version :9

Sequence 1:NP_610673.1 Gene:lambdaTry / 36214 FlyBaseID:FBgn0043470 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_001035400.1 Gene:f9b / 678552 ZFINID:ZDB-GENE-060421-7346 Length:507 Species:Danio rerio


Alignment Length:238 Identity:83/238 - (34%)
Similarity:118/238 - (49%) Gaps:21/238 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 RIVGGQDTNITQYPHQISMRYRGNH--RCGGTIYRSNQIISAAHCVNTLSGPENLTIVAGSSNIW 97
            |||||.:....:.|.|:....:.|.  .|||::.....:|:|||||....|  :..|..|..::.
Zfish   255 RIVGGDEAIPGEIPWQVVFLEKVNKIVFCGGSLLSEEWVITAAHCVEGKQG--SFFIRVGEHDVS 317

  Fly    98 FPTGPQQELEVREIIIHPKY---RTLNNDYDAAILILDGDFEFNDAVQPIELAKERPDHDTPV-- 157
            ...|.:.:..:.|..|||:|   |:|.| :|.|:|.|.......|...||.|..:  |....:  
Zfish   318 KMEGTESDHGIEEYHIHPRYNSQRSLYN-HDIALLKLKKPVILFDYAVPICLGSK--DFTENLLQ 379

  Fly   158 -----TVTGWGTTSEGGTISDVLQEVSVNVVDNSNCKNAYSIMLTSRMLCAGVNGGGKDACQGDS 217
                 .|:|||....||..|:|||:|.:..||...||.:.:..::..|.|||.:...||||||||
Zfish   380 SAENSLVSGWGRLRYGGIESNVLQKVELPYVDRIKCKGSSTDSISRFMFCAGYSTVRKDACQGDS 444

  Fly   218 GGPLV--YNNT--LLGIVSWGTGCAREKYPGVYCSVPDVLDWL 256
            |||..  |.:|  |.||||||..||:|...|:|..:...:.|:
Zfish   445 GGPHATRYKDTWFLTGIVSWGEECAKEGKYGIYTRISKYMAWI 487

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lambdaTryNP_610673.1 Tryp_SPc 35..255 CDD:214473 82/235 (35%)
Tryp_SPc 36..259 CDD:238113 82/237 (35%)
f9bNP_001035400.1 GLA 23..86 CDD:214503
EGF_CA 88..124 CDD:238011
FXa_inhibition 131..167 CDD:291342
Tryp_SPc 255..487 CDD:214473 82/236 (35%)
Tryp_SPc 256..490 CDD:238113 82/237 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.