DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lambdaTry and ST14

DIOPT Version :9

Sequence 1:NP_610673.1 Gene:lambdaTry / 36214 FlyBaseID:FBgn0043470 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_068813.1 Gene:ST14 / 6768 HGNCID:11344 Length:855 Species:Homo sapiens


Alignment Length:254 Identity:93/254 - (36%)
Similarity:132/254 - (51%) Gaps:34/254 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 RIVGGQDTNITQYPHQISMRYRG-NHRCGGTIYRSNQIISAAHCV-----NTLSGPENLTIVAGS 93
            |:|||.|.:..::|.|:|:...| .|.||.::...|.::|||||.     ...|.|...|...|.
Human   614 RVVGGTDADEGEWPWQVSLHALGQGHICGASLISPNWLVSAAHCYIDDRGFRYSDPTQWTAFLGL 678

  Fly    94 SNIWFPTGP-QQELEVREIIIHPKYRTLNNDYDAAILILDGDFEFNDAVQPIELAKERPD--HDT 155
            .:....:.| .||..::.||.||.:.....|||.|:|.|:...|::..|:||.|    ||  |..
Human   679 HDQSQRSAPGVQERRLKRIISHPFFNDFTFDYDIALLELEKPAEYSSMVRPICL----PDASHVF 739

  Fly   156 P----VTVTGWGTTSEGGTISDVLQEVSVNVVDNSNCKNAYSIMLTSRMLCAGVNGGGKDACQGD 216
            |    :.|||||.|..|||.:.:||:..:.|::.:.|:|.....:|.||:|.|...||.|:||||
Human   740 PAGKAIWVTGWGHTQYGGTGALILQKGEIRVINQTTCENLLPQQITPRMMCVGFLSGGVDSCQGD 804

  Fly   217 SGGPL--------VYNNTLLGIVSWGTGCAREKYPGVYCSVPDVLDWLVETVADKESVG 267
            |||||        ::.   .|:||||.|||:...||||..:|...||:      ||:.|
Human   805 SGGPLSSVEADGRIFQ---AGVVSWGDGCAQRNKPGVYTRLPLFRDWI------KENTG 854

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lambdaTryNP_610673.1 Tryp_SPc 35..255 CDD:214473 88/240 (37%)
Tryp_SPc 36..259 CDD:238113 89/243 (37%)
ST14NP_068813.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..20
SEA 88..>171 CDD:307516
CUB 227..332 CDD:238001
CUB 340..444 CDD:238001
LDLa 454..486 CDD:238060
LDLa 488..523 CDD:238060
LDLa 525..559 CDD:238060
LDLa 567..602 CDD:238060
Tryp_SPc 615..852 CDD:238113 90/249 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.