DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lambdaTry and 2210010C04Rik

DIOPT Version :9

Sequence 1:NP_610673.1 Gene:lambdaTry / 36214 FlyBaseID:FBgn0043470 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_075822.3 Gene:2210010C04Rik / 67373 MGIID:1914623 Length:247 Species:Mus musculus


Alignment Length:259 Identity:93/259 - (35%)
Similarity:137/259 - (52%) Gaps:20/259 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VVFLVLGVGCSLADPIYRNEEVHIPKLDGRIVGGQDTNITQYPHQISMRYRGNHRCGGTIYRSNQ 70
            ::||.. :|.::|.|:..:        |.:||||........|:|:|:. .|.|.|||::..|..
Mouse     4 LIFLAF-LGAAVALPLDDD--------DDKIVGGYTCQRNALPYQVSLN-SGYHFCGGSLINSQW 58

  Fly    71 IISAAHCVNTLSGPENLTIVAGSSNIWFPTGPQQELEVREIIIHPKY--RTLNNDYDAAILILDG 133
            ::|||||..:     .:.:..|..||....|.:|.::..:||.||.|  .|.||  |..::.|..
Mouse    59 VVSAAHCYKS-----RIQVRLGEHNIDALEGGEQFIDAAKIIRHPNYNANTYNN--DIMLIKLKT 116

  Fly   134 DFEFNDAVQPIELAKERPDHDTPVTVTGWGTTSEGGT-ISDVLQEVSVNVVDNSNCKNAYSIMLT 197
            ....|..|..:.|.:..|...|...|:|||.|...|| ...:||.:...|:.:|:|.::|...:|
Mouse   117 AATLNSRVSTVALPRSCPSAGTRCLVSGWGNTLSSGTNYPSLLQCLDAPVLSDSSCTSSYPGKIT 181

  Fly   198 SRMLCAGVNGGGKDACQGDSGGPLVYNNTLLGIVSWGTGCAREKYPGVYCSVPDVLDWLVETVA 261
            |.|.|.|...||||:||||||||:|.|..|.|:||||.|||:...||||..|...::|:.:|:|
Mouse   182 SNMFCLGFLEGGKDSCQGDSGGPVVCNGQLQGVVSWGYGCAQRGKPGVYTKVCKYVNWIQQTIA 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lambdaTryNP_610673.1 Tryp_SPc 35..255 CDD:214473 84/222 (38%)
Tryp_SPc 36..259 CDD:238113 85/225 (38%)
2210010C04RikNP_075822.3 Tryp_SPc 24..240 CDD:214473 84/223 (38%)
Tryp_SPc 25..243 CDD:238113 85/225 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.720

Return to query results.
Submit another query.