DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lambdaTry and zgc:123295

DIOPT Version :9

Sequence 1:NP_610673.1 Gene:lambdaTry / 36214 FlyBaseID:FBgn0043470 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_001032651.1 Gene:zgc:123295 / 641564 ZFINID:ZDB-GENE-051127-11 Length:310 Species:Danio rerio


Alignment Length:256 Identity:100/256 - (39%)
Similarity:143/256 - (55%) Gaps:24/256 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 LDGRIVGGQDTNITQYPHQISMR---YRGNHRCGGTIYRSNQIISAAHC----VNTLSGPENLTI 89
            |:.:|||||:.....:|.|:|::   | |.|.|||::...:.::|||||    :.|:.....|..
Zfish    32 LNTKIVGGQNAGAGSWPWQVSLQSPTY-GGHFCGGSLINKDWVLSAAHCFQDSIGTIMVKLGLQS 95

  Fly    90 VAGSSNIWFPTGPQQELE-VREIIIHPKYRTLNNDYDAAILILDGDFEFNDAVQPIELAKERPDH 153
            .:||:       |.|..: |.::|.||.|...:||.|.|::.||....|||.::|:.||.....:
Zfish    96 QSGSN-------PYQITKTVVQVINHPNYNNPSNDNDIALVKLDSSVTFNDYIEPVCLAAAGNTY 153

  Fly   154 --DTPVTVTGWG-TTSEGGTISDVLQEVSVNVVDNSNCKNAYSIMLTSRMLCAG-VNGGGKDACQ 214
              .|...||||| .:|....|.|:||||.:.:|.:|:||.||...:||.|:||| ::.||||:||
Zfish   154 AAGTLSWVTGWGKLSSAANQIPDILQEVEIPIVSHSDCKRAYPGEITSNMICAGLLDQGGKDSCQ 218

  Fly   215 GDSGGPLVYNN----TLLGIVSWGTGCAREKYPGVYCSVPDVLDWLVETVADKESVGKIDF 271
            ||||||:|..|    ...||||:|.|||...|||||..|....||:..:.......|.::|
Zfish   219 GDSGGPMVSRNGSQWIQSGIVSFGRGCAEPGYPGVYARVSQYQDWITSSTGSSNPPGFVEF 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lambdaTryNP_610673.1 Tryp_SPc 35..255 CDD:214473 95/235 (40%)
Tryp_SPc 36..259 CDD:238113 97/238 (41%)
zgc:123295NP_001032651.1 Tryp_SPc 35..264 CDD:214473 96/236 (41%)
Tryp_SPc 36..264 CDD:238113 96/235 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.