DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lambdaTry and c1s

DIOPT Version :9

Sequence 1:NP_610673.1 Gene:lambdaTry / 36214 FlyBaseID:FBgn0043470 Length:272 Species:Drosophila melanogaster
Sequence 2:XP_002941253.2 Gene:c1s / 613055 XenbaseID:XB-GENE-995410 Length:691 Species:Xenopus tropicalis


Alignment Length:264 Identity:84/264 - (31%)
Similarity:123/264 - (46%) Gaps:40/264 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 VHIPKLDGRIVGGQDTNITQYPHQISMRYRGNHRCGGTIYRSNQIISAAHCVNTLSGPENLTIVA 91
            ||.....|||.||......|:|..|  ::......||::.....:::|||.||....|   |:..
 Frog   428 VHQSDKSGRIFGGTRAKPGQFPWMI--QFTDIELGGGSLISDRWVLTAAHVVNKKIFP---TMFG 487

  Fly    92 GSSNIWFPT----GPQQELEVREIIIHPKYR-------TLNNDYDAAILILDGDFEFNDAVQPIE 145
            |... :||.    ..::.|:.::|||||.|:       ..|.|.|.|::.|....:....:.||.
 Frog   488 GVMK-FFPNTNLQSQEKRLQAKKIIIHPLYQDNEDTEGQSNFDNDIALVQLTKKVKLGSCISPIC 551

  Fly   146 LAKE--RPDHDTPVTVTGWGTTSEGGTISDVLQEVSVNVVDNSNCKNA-----YSIMLTSRMLCA 203
            |.:.  .|..:...|:.|||.|.:..:..: ||..|:::.....||.|     |   .|..||||
 Frog   552 LPRRGLAPVVNEVATIAGWGKTEKRESAVN-LQFASISLSSMDKCKKATGGKGY---FTPNMLCA 612

  Fly   204 GVNGGGKDACQGDSGGPLVYNNT-------LLGIVSWG-TGCAREKYPGVYCSVPDVLDWLVETV 260
            | :..|||:|.|||||||::.:.       :.|||||| ..|...   |:|..|.:.|||:.||:
 Frog   613 G-SDVGKDSCNGDSGGPLMFTDPQDSSKMYMAGIVSWGPRDCGTY---GLYTKVDNYLDWIEETI 673

  Fly   261 ADKE 264
            |..|
 Frog   674 AAVE 677

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lambdaTryNP_610673.1 Tryp_SPc 35..255 CDD:214473 75/245 (31%)
Tryp_SPc 36..259 CDD:238113 76/248 (31%)
c1sXP_002941253.2 CUB 21..131 CDD:238001
FXa_inhibition 145..173 CDD:405372
CUB 177..288 CDD:238001
PHA02927 301..>436 CDD:222943 2/7 (29%)
Tryp_SPc 436..669 CDD:214473 76/246 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.