DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lambdaTry and CG17242

DIOPT Version :9

Sequence 1:NP_610673.1 Gene:lambdaTry / 36214 FlyBaseID:FBgn0043470 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_001259921.1 Gene:CG17242 / 59226 FlyBaseID:FBgn0250841 Length:245 Species:Drosophila melanogaster


Alignment Length:224 Identity:69/224 - (30%)
Similarity:102/224 - (45%) Gaps:18/224 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 ITQYPHQISMRYRGNHRCGGTIYRSNQIISAAHCVNTLSGPENLTIVAGSS--NIWFPTGPQQEL 106
            |.|.|.|.|::....|.|||.||..:.|::.|.||.. :..|.:::..||:  |........:::
  Fly    24 IEQAPWQASVQINDKHHCGGVIYSEDIILTIAECVRK-ARLEFISVRVGSAQENAGGTVLKVEKM 87

  Fly   107 EVREIIIHPKYRTLNNDYDAAILILDGDFEFNDAVQPIELAKERPDHDTPVTVTGWGTTSEGGTI 171
            .::.:.:.|.        |.|||.|......:..::.|.||.......|..:|:|||..|.....
  Fly    88 RLQVLGLRPS--------DVAILQLRSPLYLDGGIRAIPLATIPLVPGTNASVSGWGQLSAMNPS 144

  Fly   172 SDVLQEVSVNVVDNSNCKNAYSIMLTSRM-----LCAGVNGGGKDACQGDSGGPLVYNNTLLGIV 231
            |:||..|.|.:.|...|  |.::.|..|:     :||...|....||||..|||||.||.|.||:
  Fly   145 SEVLLRVDVKIQDQLMC--ATNLALKGRLMSVGEICAAPAGEIPYACQGFVGGPLVANNRLYGIL 207

  Fly   232 SWGTGCAREKYPGVYCSVPDVLDWLVETV 260
            ||.:.|.......||.::.....|:..||
  Fly   208 SWQSACDVLNKSSVYANIAMFKVWIESTV 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lambdaTryNP_610673.1 Tryp_SPc 35..255 CDD:214473 66/217 (30%)
Tryp_SPc 36..259 CDD:238113 67/221 (30%)
CG17242NP_001259921.1 Tryp_SPc 24..235 CDD:238113 67/221 (30%)
Tryp_SPc 24..232 CDD:214473 66/218 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 1 1.000 - - FOG0000678
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.