DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lambdaTry and CG34290

DIOPT Version :9

Sequence 1:NP_610673.1 Gene:lambdaTry / 36214 FlyBaseID:FBgn0043470 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_001097899.2 Gene:CG34290 / 5740609 FlyBaseID:FBgn0085319 Length:282 Species:Drosophila melanogaster


Alignment Length:265 Identity:75/265 - (28%)
Similarity:119/265 - (44%) Gaps:48/265 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 EEVH-IPKLDGRIVGGQDTNITQYPHQISMR------------YRGNHRCGGTIYRSNQIISAAH 76
            |..| :|.:.||||....::.::||..:|::            |:  |.|||::.....|:||||
  Fly    27 ESCHAVPIVGGRIVSTVGSSTSKYPFMVSLQDVITRNTTNGVSYQ--HFCGGSLISDRWILSAAH 89

  Fly    77 CVNTLSGPENLTIVA---GSSNI-----WFPTGPQQELEVREIIIHPKYRTLNNDYDAAILILDG 133
            ||    ..:|:..:|   |..||     ..|.|    ||..|.|.   ::..|...|.|:|.:..
  Fly    90 CV----WRKNIHYIAAFIGYENIENIGQLQPYG----LESVEYIY---FQPSNFRNDIALLYMKR 143

  Fly   134 DF--EFNDAVQPIELAKE--RPDHDTPVTVTGWGTTSEGGTISDVLQEVSVNVVDNSNCK----N 190
            .:  :|.:.:|..:|...  :||.:....:.|:|.|...|.....|.|..|.|:||..|:    :
  Fly   144 RYWSDFGNGLQYAQLPPHGMKPDQNESCRIIGYGATHHAGPCQKRLFEAEVRVIDNQKCRDIIGH 208

  Fly   191 AYSIMLTSRMLCAGVNGGGKDACQGDSGGPLVY----NNTLLGIVSWGTGCAREKYPGVYCSVPD 251
            .::....:..:||  .|..:|:|||||||||:.    .:.:.|:||.|..|.....|.:|.....
  Fly   209 IWAPQNGANTVCA--LGNNQDSCQGDSGGPLICTYGGKDYIYGLVSHGLTCGIPGMPSIYTVTRP 271

  Fly   252 VLDWL 256
            ..||:
  Fly   272 YYDWV 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lambdaTryNP_610673.1 Tryp_SPc 35..255 CDD:214473 69/251 (27%)
Tryp_SPc 36..259 CDD:238113 70/253 (28%)
CG34290NP_001097899.2 Tryp_SPc 34..277 CDD:238113 72/258 (28%)
Tryp_SPc 34..276 CDD:214473 71/256 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.