DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lambdaTry and CG34295

DIOPT Version :9

Sequence 1:NP_610673.1 Gene:lambdaTry / 36214 FlyBaseID:FBgn0043470 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_001097956.1 Gene:CG34295 / 5740413 FlyBaseID:FBgn0085324 Length:288 Species:Drosophila melanogaster


Alignment Length:232 Identity:48/232 - (20%)
Similarity:82/232 - (35%) Gaps:67/232 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 QYPHQISMRYR----------GNH-RCGGTIYRSNQIISAAHCV-NTLSGPENLTIVAGSSNIWF 98
            :|.::|.|.:.          ||. ||...:...:..|:::.|. |....|..:....|      
  Fly    67 EYQNEIGMSHLQFSFIAKIKVGNAVRCSAALVAPSLAITSSKCFSNDSFKPLQIIFTGG------ 125

  Fly    99 PTGPQQELEVREIIIHPKYRTLNNDY--DAAILILDGDFEFNDAVQPIELAKERPDHDTPVTVTG 161
                      |.|.:.   ..:..|:  :.:||.|....|.|    ||.|.:    :|.|:    
  Fly   126 ----------RTIAVD---NVVKADFCPELSILHLKRPSEIN----PIALCQ----YDVPL---- 165

  Fly   162 WGTTSEGGTISDVLQEVS---------VNVVDNSNCKNAY----SIMLTSRMLCAGVNGGGKDAC 213
                   ||...::...|         ..::.|..||..:    |:.:|..|||| .|....:.|
  Fly   166 -------GTRVSMMMATSDLRYYGRRRTEIISNRACKTTFLEEDSVFITPSMLCA-KNSMNPEMC 222

  Fly   214 QGDSGGPLVYNNTLLGIVSWGTGCAREKYPG-VYCSV 249
            ....|..|:.::.|.|:..:|..|.:....| :|.|:
  Fly   223 ATSPGDVLLIDHQLCGLNVYGFRCFQNALNGDLYISL 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lambdaTryNP_610673.1 Tryp_SPc 35..255 CDD:214473 48/232 (21%)
Tryp_SPc 36..259 CDD:238113 48/232 (21%)
CG34295NP_001097956.1 Tryp_SPc 78..>213 CDD:304450 32/172 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.