DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lambdaTry and si:dkeyp-93a5.2

DIOPT Version :9

Sequence 1:NP_610673.1 Gene:lambdaTry / 36214 FlyBaseID:FBgn0043470 Length:272 Species:Drosophila melanogaster
Sequence 2:XP_021326346.1 Gene:si:dkeyp-93a5.2 / 571079 ZFINID:ZDB-GENE-131127-18 Length:130 Species:Danio rerio


Alignment Length:90 Identity:38/90 - (42%)
Similarity:52/90 - (57%) Gaps:4/90 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   175 LQEVSVNVVDNSNCKNAYSIMLTSRMLCAGVNGGGKDACQGDSGGPLVYNNTLL----GIVSWGT 235
            ||:..|.||.||:|.|.....:|..|:|||:..||||.||||||||:|.....:    ||:|.|.
Zfish    16 LQQTVVPVVINSDCNNLLGATITDNMMCAGLLQGGKDTCQGDSGGPMVSQQCSVWVQSGIISKGH 80

  Fly   236 GCAREKYPGVYCSVPDVLDWLVETV 260
            .|.:...||||..|....:|::.::
Zfish    81 DCGQPYEPGVYTRVSQYQNWIMSSI 105

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lambdaTryNP_610673.1 Tryp_SPc 35..255 CDD:214473 37/83 (45%)
Tryp_SPc 36..259 CDD:238113 38/87 (44%)
si:dkeyp-93a5.2XP_021326346.1 Tryp_SPc <9..103 CDD:238113 38/86 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.