DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lambdaTry and si:dkey-21e2.15

DIOPT Version :9

Sequence 1:NP_610673.1 Gene:lambdaTry / 36214 FlyBaseID:FBgn0043470 Length:272 Species:Drosophila melanogaster
Sequence 2:XP_003201076.1 Gene:si:dkey-21e2.15 / 567711 ZFINID:ZDB-GENE-050208-780 Length:251 Species:Danio rerio


Alignment Length:271 Identity:71/271 - (26%)
Similarity:116/271 - (42%) Gaps:27/271 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 ILVVFLVLGVGCSLADPIYRNEEVHIPKLDGRIVGGQDTNITQYPHQISMRYRGNHRCGGTIYRS 68
            |:::.|:|.|  ||...:.....|.|.       .|.:......|:.:|::....:.|||::...
Zfish     3 IIIISLLLLV--SLVPDLTFTARVGIE-------DGTEAKPHSRPYMVSLQKNSKNSCGGSLITE 58

  Fly    69 NQIISAAHCVNTLSGPENLTIVAGSSNIWFPTGPQQELEVREIIIHPKYRTLNNDYDAAILILDG 133
            ..:::||||   ....:.:|:|.|:.:: .........||...|.||::...|.:.|..:|.|:.
Zfish    59 EFVLTAAHC---WKKGDVITVVVGAHDL-SENETYDSFEVTSYIPHPEFSWQNYENDIMLLKLNK 119

  Fly   134 DFEFNDAVQPIELAKERPD--HDTPVTVTGWGTTSEGGTISDVLQEVSVNVVDNSNCKNAY-SIM 195
            ....::.|..|.|.|...|  .|...:|.|||.....|...|.|.|....:|....||..: |:.
Zfish   120 KVTLSNNVGLISLPKNGEDVKEDAVCSVAGWGRLWLNGPRPDRLMEAETVIVSGEECKRRWESLF 184

  Fly   196 LTSRMLCAGVNGGGKDACQGDSGGPLVYNNTLLGIVSWGT--GCAREKYPGVYCSVPDVLDWLVE 258
            ..|:|.|...:||   .|:||||||||.....:|:.|:..  .|.....|.:|..:...|.|:  
Zfish   185 KPSKMFCVYGHGG---TCKGDSGGPLVCGEHAVGVTSFSDRYSCNSRLLPNMYTKISAYLSWI-- 244

  Fly   259 TVADKESVGKI 269
                ::..||:
Zfish   245 ----QKITGKV 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lambdaTryNP_610673.1 Tryp_SPc 35..255 CDD:214473 60/224 (27%)
Tryp_SPc 36..259 CDD:238113 61/227 (27%)
si:dkey-21e2.15XP_003201076.1 Tryp_SPc 26..247 CDD:238113 62/240 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.