DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lambdaTry and AgaP_AGAP012472

DIOPT Version :9

Sequence 1:NP_610673.1 Gene:lambdaTry / 36214 FlyBaseID:FBgn0043470 Length:272 Species:Drosophila melanogaster
Sequence 2:XP_001687805.1 Gene:AgaP_AGAP012472 / 5668361 VectorBaseID:AGAP012472 Length:163 Species:Anopheles gambiae


Alignment Length:154 Identity:41/154 - (26%)
Similarity:67/154 - (43%) Gaps:17/154 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 EEVHI------PKLDGRIVGGQDTNITQYPHQISMRYRGNHRCGGTIYRSNQIISAAHCVNT-LS 82
            :::||      ....||||.|...:|..|...:|:|....:.|||:|.....::||||||.. |.
Mosquito    12 DDIHIHGKTKGVARSGRIVNGVPVSIENYKFAVSLRIDDQYFCGGSIISVPHVLSAAHCVYPFLK 76

  Fly    83 GPENLTIVAGSSNIWFPTGPQQELEVREIIIHPKYRTLN-----NDYD-AAILILDGDFEFNDAV 141
            ....:::..||::   |......:.|...:.||.::. |     :|:| ||:.:..........:
Mosquito    77 NISRMSVYGGSTS---PFSGGVSIPVIRAVNHPDFKP-NPPSGLHDFDVAALTVPTNALRGRPNM 137

  Fly   142 QPIELAKERPDHDTPVTVTGWGTT 165
            .||.:...:....|...|.|||.|
Mosquito   138 APISIQNVQVPAGTRCYVVGWGWT 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lambdaTryNP_610673.1 Tryp_SPc 35..255 CDD:214473 38/138 (28%)
Tryp_SPc 36..259 CDD:238113 37/137 (27%)
AgaP_AGAP012472XP_001687805.1 Tryp_SPc 29..>159 CDD:304450 34/133 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
21.870

Return to query results.
Submit another query.