DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lambdaTry and AgaP_AGAP001251

DIOPT Version :9

Sequence 1:NP_610673.1 Gene:lambdaTry / 36214 FlyBaseID:FBgn0043470 Length:272 Species:Drosophila melanogaster
Sequence 2:XP_001689373.2 Gene:AgaP_AGAP001251 / 5667665 VectorBaseID:AGAP001251 Length:290 Species:Anopheles gambiae


Alignment Length:284 Identity:86/284 - (30%)
Similarity:123/284 - (43%) Gaps:51/284 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 ILVVFLVLGVGCSLAD----------------------PIYRNEEVHI--PKLDGR-----IVGG 39
            :|:..||.||.|...|                      |  |||.:..  |:.|..     |.||
Mosquito     5 LLLAALVGGVLCMTVDYNKYYYSRQPDLFRLLRKYHLWP--RNETLKFERPRQDLNVPSPFIFGG 67

  Fly    40 QDTNITQYPHQISMRYRGNHRCGGTIYRSNQIISAAHCVNTLSGPENLTIVAGSSNIWFPTGPQQ 104
            :...|..||:|:|:|..|.|.||.::......:|||||::....|..:|...|:        |.:
Mosquito    68 ESVAIESYPYQLSLRLEGTHICGASVIAERWALSAAHCLDEALYPSAITFRGGT--------PHR 124

  Fly   105 -----ELEVREIIIHPKY--RTLNNDYDAAILILDGDFEFNDAVQPIELAKERPDHDTP--VTVT 160
                 .......::|||:  |||  |||.::..:...| |.|.::.:.||.....:..|  ..||
Mosquito   125 LAGGYIFHAEYYLLHPKFDRRTL--DYDVSVTHVRESF-FIDPIRAVTLANTNTYYPIPSAAVVT 186

  Fly   161 GWGTTSEGGTISDVLQEVSVNVVDNSNCKNAYSIMLTSRMLCAGVNGGGKDACQGDSGGPLVYNN 225
            |||.....|....:||.:.:.:.....|..:....||.|.:|.|....||:.|.||||||||.|.
Mosquito   187 GWGLADADGYEPLILQSLEIYLQQKQFCWTSTIEALTDRQICGGSGVYGKETCYGDSGGPLVMNG 251

  Fly   226 TLLGIVSWGTGCAREKYPGVYCSV 249
            ..:||||||:.......||:|.|:
Mosquito   252 YQVGIVSWGSDNCAVNIPGIYTSL 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lambdaTryNP_610673.1 Tryp_SPc 35..255 CDD:214473 73/229 (32%)
Tryp_SPc 36..259 CDD:238113 73/223 (33%)
AgaP_AGAP001251XP_001689373.2 Tryp_SPc 64..277 CDD:214473 73/223 (33%)
Tryp_SPc 64..277 CDD:238113 73/223 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D109274at50557
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.