DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lambdaTry and AgaP_AGAP005690

DIOPT Version :9

Sequence 1:NP_610673.1 Gene:lambdaTry / 36214 FlyBaseID:FBgn0043470 Length:272 Species:Drosophila melanogaster
Sequence 2:XP_001688708.1 Gene:AgaP_AGAP005690 / 5667342 VectorBaseID:AGAP005690 Length:300 Species:Anopheles gambiae


Alignment Length:256 Identity:83/256 - (32%)
Similarity:126/256 - (49%) Gaps:33/256 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 EVHIPKLDG-RIVGGQDTNITQYPHQISMRYR---GNHRCGGTIYRSNQIISAAHCVNTLSGPEN 86
            :|:..||.. ||..||:....|:|.||::...   ||..|||::...|.|::|||||  :||...
Mosquito    45 QVYREKLPSHRITNGQEATPGQFPFQIALISEFASGNGLCGGSVLTRNFILTAAHCV--VSGAST 107

  Fly    87 L----TIVAGSSNIWFPTGPQQELE-----VREIIIHPKY--RTLNNDYDAAILILDGDFEFNDA 140
            |    ..:.|:.|.......||.:.     :|.   ||.|  .||.|  |.|.:.|:....|...
Mosquito   108 LASGGVAIMGAHNRNIQESTQQRIRFATSGIRR---HPSYSSSTLRN--DIATVRLNSPMTFTTR 167

  Fly   141 VQPIEL---AKERPDHDTPVTVTGWGTTSEGGTISDVLQEVSVN-VVDNSNCKNAYSIMLTSRML 201
            :|||.|   :..|.......||:|:|.||:..:.:..:...:.| |:.|::|...:...:.::.:
Mosquito   168 IQPIRLPGRSDTRQFGGFTGTVSGFGRTSDASSATSAVVRFTTNPVMTNTDCIARWGSTVVNQHV 232

  Fly   202 CAGVNGGGKDACQGDSGGPLVYNN--TL-LGIVSWGT--GCAREKYPGVYCSVPDVLDWLV 257
            |.. ..||:.:|.|||||||...:  |: :|:||:|:  ||| ...|.||..|...|||:|
Mosquito   233 CLS-GAGGRSSCNGDSGGPLTVQSGGTMQIGVVSFGSVNGCA-IGMPSVYARVTFFLDWIV 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lambdaTryNP_610673.1 Tryp_SPc 35..255 CDD:214473 77/242 (32%)
Tryp_SPc 36..259 CDD:238113 79/245 (32%)
AgaP_AGAP005690XP_001688708.1 Tryp_SPc 55..290 CDD:214473 78/243 (32%)
Tryp_SPc 56..290 CDD:238113 77/242 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.