DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lambdaTry and TMPRSS4

DIOPT Version :9

Sequence 1:NP_610673.1 Gene:lambdaTry / 36214 FlyBaseID:FBgn0043470 Length:272 Species:Drosophila melanogaster
Sequence 2:XP_005271670.1 Gene:TMPRSS4 / 56649 HGNCID:11878 Length:494 Species:Homo sapiens


Alignment Length:279 Identity:100/279 - (35%)
Similarity:146/279 - (52%) Gaps:42/279 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSRILVVFLVLGVGCSLADPIYRNEEVHIPKLDGRIVGGQDTNITQYPHQISMRYRGNHRCGGTI 65
            :|..||....|..|.||..|              |:||.::.::..:|.|:|::|...|.|||:|
Human   184 LSGSLVSLHCLACGKSLKTP--------------RVVGVEEASVDSWPWQVSIQYDKQHVCGGSI 234

  Fly    66 YRSNQIISAAHCVNTLSGPENLTIVAGSSNIW-FPTGPQQELEVREIII---HPKYRTLNNDYDA 126
            ...:.:::||||....:...|..:.|||..:. ||:     |.|.:|||   :|.|   ..|.|.
Human   235 LDPHWVLTAAHCFRKHTDVFNWKVRAGSDKLGSFPS-----LAVAKIIIIEFNPMY---PKDNDI 291

  Fly   127 AILILDGDFEFNDAVQPIELAKERPDHD------TPVTVTGWGTTSE-GGTISDVLQEVSVNVVD 184
            |::.|.....|:..|:||.|    |..|      ||:.:.|||.|.: ||.:||:|.:.||.|:|
Human   292 ALMKLQFPLTFSGTVRPICL----PFFDEELTPATPLWIIGWGFTKQNGGKMSDILLQASVQVID 352

  Fly   185 NSNCK--NAYSIMLTSRMLCAGVNGGGKDACQGDSGGPLVYNNT---LLGIVSWGTGCAREKYPG 244
            ::.|.  :||...:|.:|:|||:..||.|.|||||||||:|.:.   ::||||||.||.....||
Human   353 STRCNADDAYQGEVTEKMMCAGIPEGGVDTCQGDSGGPLMYQSDQWHVVGIVSWGYGCGGPSTPG 417

  Fly   245 VYCSVPDVLDWLVETVADK 263
            ||..|...|:|:.....|:
Human   418 VYTKVSAYLNWIYNVWKDR 436

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lambdaTryNP_610673.1 Tryp_SPc 35..255 CDD:214473 90/235 (38%)
Tryp_SPc 36..259 CDD:238113 90/238 (38%)
TMPRSS4XP_005271670.1 LDLa 58..92 CDD:238060
SRCR_2 108..197 CDD:295335 4/12 (33%)
Tryp_SPc 204..429 CDD:214473 90/236 (38%)
Tryp_SPc 205..432 CDD:238113 90/238 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H80930
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.