DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lambdaTry and PRSS3

DIOPT Version :9

Sequence 1:NP_610673.1 Gene:lambdaTry / 36214 FlyBaseID:FBgn0043470 Length:272 Species:Drosophila melanogaster
Sequence 2:XP_011516267.1 Gene:PRSS3 / 5646 HGNCID:9486 Length:333 Species:Homo sapiens


Alignment Length:246 Identity:91/246 - (36%)
Similarity:126/246 - (51%) Gaps:10/246 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 PIYRNEE--VHIP-KLDGRIVGGQDTNITQYPHQISMRYRGNHRCGGTIYRSNQIISAAHCVNTL 81
            ||....|  |.:| ..|.:||||........|:|:|:. .|:|.|||::.....::|||||..| 
Human    91 PIRNQNELGVAVPFDDDDKIVGGYTCEENSLPYQVSLN-SGSHFCGGSLISEQWVVSAAHCYKT- 153

  Fly    82 SGPENLTIVAGSSNIWFPTGPQQELEVREIIIHPKYRTLNNDYDAAILILDGDFEFNDAVQPIEL 146
                .:.:..|..||....|.:|.:...:||.||||.....|.|..::.|......|..|..|.|
Human   154 ----RIQVRLGEHNIKVLEGNEQFINAAKIIRHPKYNRDTLDNDIMLIKLSSPAVINARVSTISL 214

  Fly   147 AKERPDHDTPVTVTGWGTT-SEGGTISDVLQEVSVNVVDNSNCKNAYSIMLTSRMLCAGVNGGGK 210
            ....|...|...::|||.| |.|....|.|:.:...|:..:.||.:|...:|:.|.|.|...|||
Human   215 PTTPPAAGTECLISGWGNTLSFGADYPDELKCLDAPVLTQAECKASYPGKITNSMFCVGFLEGGK 279

  Fly   211 DACQGDSGGPLVYNNTLLGIVSWGTGCAREKYPGVYCSVPDVLDWLVETVA 261
            |:||.|||||:|.|..|.|:||||.|||.:..||||..|.:.:||:.:|:|
Human   280 DSCQRDSGGPVVCNGQLQGVVSWGHGCAWKNRPGVYTKVYNYVDWIKDTIA 330

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lambdaTryNP_610673.1 Tryp_SPc 35..255 CDD:214473 81/220 (37%)
Tryp_SPc 36..259 CDD:238113 83/223 (37%)
PRSS3XP_011516267.1 Tryp_SPc 109..325 CDD:214473 82/221 (37%)
Tryp_SPc 110..328 CDD:238113 83/223 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm42242
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.720

Return to query results.
Submit another query.