DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lambdaTry and PRSS2

DIOPT Version :9

Sequence 1:NP_610673.1 Gene:lambdaTry / 36214 FlyBaseID:FBgn0043470 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_001290343.1 Gene:PRSS2 / 5645 HGNCID:9483 Length:261 Species:Homo sapiens


Alignment Length:268 Identity:93/268 - (34%)
Similarity:133/268 - (49%) Gaps:24/268 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 ILVVFLVLGVGCSLADPIYRNEEVHIPKLDGRIVGGQDTNITQYPHQISMRYRGNHRCGGTIYRS 68
            :::.|:...|.....|             |.:||||........|:|:|:. .|.|.|||::...
Human     5 LILTFVAAAVAAPFDD-------------DDKIVGGYICEENSVPYQVSLN-SGYHFCGGSLISE 55

  Fly    69 NQIISAAHC----VNT-LSGP----ENLTIVAGSSNIWFPTGPQQELEVREIIIHPKYRTLNNDY 124
            ..::||.||    :|: |||.    ..:.:..|..||....|.:|.:...:||.||||.:...|.
Human    56 QWVVSAGHCYKSAINSKLSGRGCEYHRIQVRLGEHNIEVLEGNEQFINAAKIIRHPKYNSRTLDN 120

  Fly   125 DAAILILDGDFEFNDAVQPIELAKERPDHDTPVTVTGWGTT-SEGGTISDVLQEVSVNVVDNSNC 188
            |..::.|......|..|..|.|....|...|...::|||.| |.|....|.||.:...|:..:.|
Human   121 DILLIKLSSPAVINSRVSAISLPTAPPAAGTESLISGWGNTLSSGADYPDELQCLDAPVLSQAEC 185

  Fly   189 KNAYSIMLTSRMLCAGVNGGGKDACQGDSGGPLVYNNTLLGIVSWGTGCAREKYPGVYCSVPDVL 253
            :.:|...:|:.|.|.|...||||:||||||||:|.|..|.||||||.|||::..||||..|.:.:
Human   186 EASYPGKITNNMFCVGFLEGGKDSCQGDSGGPVVSNGELQGIVSWGYGCAQKNRPGVYTKVYNYV 250

  Fly   254 DWLVETVA 261
            ||:.:|:|
Human   251 DWIKDTIA 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lambdaTryNP_610673.1 Tryp_SPc 35..255 CDD:214473 85/229 (37%)
Tryp_SPc 36..259 CDD:238113 87/232 (38%)
PRSS2NP_001290343.1 Tryp_SPc 23..253 CDD:214473 86/230 (37%)
Tryp_SPc 24..256 CDD:238113 87/232 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm42242
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.