DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lambdaTry and PRSS1

DIOPT Version :9

Sequence 1:NP_610673.1 Gene:lambdaTry / 36214 FlyBaseID:FBgn0043470 Length:272 Species:Drosophila melanogaster
Sequence 2:XP_011514713.1 Gene:PRSS1 / 5644 HGNCID:9475 Length:472 Species:Homo sapiens


Alignment Length:232 Identity:87/232 - (37%)
Similarity:123/232 - (53%) Gaps:11/232 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 DGRIVGGQDTNITQYPHQISMRYRGNHRCGGTIYRSNQIISAAHCVNTLSGPENLTIVAGSSNIW 97
            |.:||||.:......|:|:|:. .|.|.|||::.....::||.||..:     .:.:..|..||.
Human   246 DDKIVGGYNCEENSVPYQVSLN-SGYHFCGGSLINEQWVVSAGHCYKS-----RIQVRLGEHNIE 304

  Fly    98 FPTGPQQELEVREIIIHPKY--RTLNNDYDAAILILDGDFEFNDAVQPIELAKERPDHDTPVTVT 160
            ...|.:|.:...:||.||:|  :||||  |..::.|......|..|..|.|....|...|...::
Human   305 VLEGNEQFINAAKIIRHPQYDRKTLNN--DIMLIKLSSRAVINARVSTISLPTAPPATGTKCLIS 367

  Fly   161 GWG-TTSEGGTISDVLQEVSVNVVDNSNCKNAYSIMLTSRMLCAGVNGGGKDACQGDSGGPLVYN 224
            ||| |.|.|....|.||.:...|:..:.|:.:|...:||.|.|.|...||||:||||||||:|.|
Human   368 GWGNTASSGADYPDELQCLDAPVLSQAKCEASYPGKITSNMFCVGFLEGGKDSCQGDSGGPVVCN 432

  Fly   225 NTLLGIVSWGTGCAREKYPGVYCSVPDVLDWLVETVA 261
            ..|.|:||||.|||::..||||..|.:.:.|:..|:|
Human   433 GQLQGVVSWGDGCAQKNKPGVYTKVYNYVKWIKNTIA 469

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lambdaTryNP_610673.1 Tryp_SPc 35..255 CDD:214473 83/222 (37%)
Tryp_SPc 36..259 CDD:238113 84/225 (37%)
PRSS1XP_011514713.1 Ig 19..119 CDD:299845
IG_like 29..113 CDD:214653
Tryp_SPc 248..464 CDD:214473 83/223 (37%)
Tryp_SPc 249..467 CDD:238113 84/225 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm42242
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.720

Return to query results.
Submit another query.