DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lambdaTry and tmprss9

DIOPT Version :9

Sequence 1:NP_610673.1 Gene:lambdaTry / 36214 FlyBaseID:FBgn0043470 Length:272 Species:Drosophila melanogaster
Sequence 2:XP_021325244.1 Gene:tmprss9 / 562051 ZFINID:ZDB-GENE-050208-573 Length:788 Species:Danio rerio


Alignment Length:243 Identity:87/243 - (35%)
Similarity:134/243 - (55%) Gaps:20/243 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 PKLDGRIVGGQDTNITQYPHQISMRYRGNHRCGGTIYRSNQIISAAHCVNTLSGPENLTIVAGSS 94
            |.:..|||||::|...::|.|:|:|.||.|.||.:|..|..::|||||....:.|::.|.:.|::
Zfish   226 PVMSNRIVGGENTRHGEFPWQVSLRLRGRHTCGASIVNSRWLVSAAHCFEVENNPKDWTALVGAN 290

  Fly    95 NIWFPTGPQQE---LEVREIIIHPKYRTLNNDYDAAILILDGDFEFNDAVQPIELAKERPDH-DT 155
            .:   :|.:.|   :.::.:::.|||..:..|.|..:|.|:...:|:..|||:.:...  .| .|
Zfish   291 QV---SGAEAEAFIVNIKSLVMSPKYDPMTTDSDVTVLELETPLKFSHYVQPVCIPSS--SHVFT 350

  Fly   156 P---VTVTGWGTTSEGGT-ISDVLQEVSVNVVDNSNC--KNAYSIMLTSRMLCAGVNGGGKDACQ 214
            |   ..|:|||..::..| :...||:..|.::|:..|  .:.|...||..|:|||...|..|:||
Zfish   351 PGQNCIVSGWGALNQYTTEVPSTLQKAIVKIIDSKVCNKSSVYRGALTQNMMCAGFLQGKVDSCQ 415

  Fly   215 GDSGGPLVYNNT-----LLGIVSWGTGCAREKYPGVYCSVPDVLDWLV 257
            |||||||.....     |.||||||.|||:...||||..|..:.:|:|
Zfish   416 GDSGGPLACEVAAGRYFLAGIVSWGVGCAQINKPGVYSRVTKLRNWIV 463

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lambdaTryNP_610673.1 Tryp_SPc 35..255 CDD:214473 84/234 (36%)
Tryp_SPc 36..259 CDD:238113 85/237 (36%)
tmprss9XP_021325244.1 SEA 52..146 CDD:307516
LDLa 185..220 CDD:238060
Tryp_SPc 232..462 CDD:238113 83/234 (35%)
LDLa 510..544 CDD:238060
Tryp_SPc 557..783 CDD:238113
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.