DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lambdaTry and zmp:0000001088

DIOPT Version :9

Sequence 1:NP_610673.1 Gene:lambdaTry / 36214 FlyBaseID:FBgn0043470 Length:272 Species:Drosophila melanogaster
Sequence 2:XP_688573.1 Gene:zmp:0000001088 / 560086 ZFINID:ZDB-GENE-140106-48 Length:263 Species:Danio rerio


Alignment Length:272 Identity:93/272 - (34%)
Similarity:136/272 - (50%) Gaps:41/272 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 ILVVFLVLGVGCSLADPIYRNEEVHIPKLDGRIVGGQDTNITQYPHQISMRY-------RGNHRC 61
            :.|:..:|.|.|         ::|    :..|||||      ..|...|::|       .|.|.|
Zfish     8 LCVLLEILAVSC---------QDV----IQARIVGG------YVPAPYSIKYIVSIQSATGQHFC 53

  Fly    62 GGTIYRSNQIISAAHCVNTLSGPENLTIVAGSSNIWFPTGPQQELEVREIIIHPKYRTLNNDYDA 126
            |||:.....:::|||| |.  |..|:.||||..::....|.:|......:|.||:|....|:.|.
Zfish    54 GGTLINKYWVLTAAHC-NI--GEANMRIVAGDYSVGLYEGMEQFRRPHMLIPHPQYDRSTNNADI 115

  Fly   127 AILILDGDFEFNDAVQPIELAKERPDHDTPV------TVTGWGTTSEGGTISDVLQEVSVNVVDN 185
            .::.|......|..|..:.|    |..|..|      :|:|||.|:..|.||.:|:.|.:.:|..
Zfish   116 MLIKLQSPVYLNSYVSLVPL----PRQDAMVAVGRLCSVSGWGFTTSTGGISSILRTVKLPIVST 176

  Fly   186 SNCK--NAYSIMLTSRMLCAGVNGGGKDACQGDSGGPLVYNNTLLGIVSWGTGCAREKYPGVYCS 248
            :.|.  ::::..:|..|:|||.:.||||||:||||||||....:.||||||.|||..:|||||.:
Zfish   177 AVCNGTDSFNGNITENMICAGYSTGGKDACKGDSGGPLVCEGRVYGIVSWGNGCADAQYPGVYTA 241

  Fly   249 VPDVLDWLVETV 260
            |.....|:..|:
Zfish   242 VSQFRQWIDATI 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lambdaTryNP_610673.1 Tryp_SPc 35..255 CDD:214473 86/234 (37%)
Tryp_SPc 36..259 CDD:238113 86/237 (36%)
zmp:0000001088XP_688573.1 Tryp_SPc 26..249 CDD:214473 86/235 (37%)
Tryp_SPc 27..252 CDD:238113 86/237 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.