DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lambdaTry and zgc:154142

DIOPT Version :9

Sequence 1:NP_610673.1 Gene:lambdaTry / 36214 FlyBaseID:FBgn0043470 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_001092710.1 Gene:zgc:154142 / 555481 ZFINID:ZDB-GENE-070615-2 Length:1090 Species:Danio rerio


Alignment Length:265 Identity:76/265 - (28%)
Similarity:121/265 - (45%) Gaps:34/265 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 PKLDGRIVGGQDTNITQYPHQISMRYRGN-------HRCGGTIYRSNQIISAAHC-VNTLSGPEN 86
            |.::.|||.|:..|...:|.|:||:...:       |.||||:...|.:::|||| :........
Zfish   581 PAVNTRIVNGEPANPHSWPWQVSMQVLRDSEPPMLGHTCGGTLIHKNWVLTAAHCFIRYADELHR 645

  Fly    87 LTIVAGSSNIWFPTGPQQELEVREIIIHP--KYRTLNN-DYDAAILILDGDFEFNDAVQPIELA- 147
            ..:..|..|:......:|...|..|..|.  :|.|:.. ::|.|::.|||:.   .|.:.|:.| 
Zfish   646 WKMCLGKHNLTVSESTEQCFNVLGIYRHEGFQYPTVPTVEFDIALVRLDGEV---TATEHIDFAC 707

  Fly   148 ----KERPDHDTPVTVTGWGTTSEGGT---ISDVLQEVSVNVVDNSNCK--NAYSIMLTSRMLCA 203
                :|..........||||..:...|   :::.|.:|::.||....||  :.:...:.:.|:|.
Zfish   708 LPSFEELLPGGKKCYATGWGDETGNSTAPKVAETLNQVALPVVPYETCKRMDYWWFQVKTSMICC 772

  Fly   204 GVNGGG--KDACQGDSGGPLVYNNT------LLGIVSWG-TGCAREKYPGVYCSVPDVLDWLVET 259
            |.....  |..||||||||||..::      :.||.|:| .||..:|.|.|:......|.| :|.
Zfish   773 GYTSPDELKSVCQGDSGGPLVCQDSPSAPWEVHGITSFGPIGCVFDKKPSVFTRSSVYLPW-IEN 836

  Fly   260 VADKE 264
            |..|:
Zfish   837 VIRKD 841

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lambdaTryNP_610673.1 Tryp_SPc 35..255 CDD:214473 71/249 (29%)
Tryp_SPc 36..259 CDD:238113 71/252 (28%)
zgc:154142NP_001092710.1 CUB 57..159 CDD:238001
CUB 172..280 CDD:238001
CUB 310..420 CDD:238001
CUB 432..546 CDD:238001
Tryp_SPc 586..834 CDD:214473 72/251 (29%)
Tryp_SPc 587..837 CDD:238113 72/253 (28%)
CUB 850..959 CDD:238001
CUB 971..1080 CDD:238001
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.