DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lambdaTry and ctrb.3

DIOPT Version :9

Sequence 1:NP_610673.1 Gene:lambdaTry / 36214 FlyBaseID:FBgn0043470 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_001017724.1 Gene:ctrb.3 / 550419 ZFINID:ZDB-GENE-050417-229 Length:265 Species:Danio rerio


Alignment Length:275 Identity:87/275 - (31%)
Similarity:137/275 - (49%) Gaps:40/275 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VVFLVLGVGCSL-ADPIYRNEEVHIPKLDG--RIVGGQDTNITQYPHQISMR-YRGNHRCGGTIY 66
            |.|.....||.: |.|         |.:.|  |||.|::.....:|.|:|:: :.|.|.|||::.
Zfish    10 VAFFSAAYGCGVPAIP---------PVVSGYARIVNGEEAVPHSWPWQVSLQDFTGFHFCGGSLI 65

  Fly    67 RSNQIISAAHC-VNT----LSGPENLTIVAGSSNIWFPTGPQQELE---VREIIIHPKYRTLNND 123
            ....:::|||| |.|    :.|..|    .|.||      .|::::   |.::..||:|.:...:
Zfish    66 NEFWVVTAAHCSVRTSHRVILGEHN----KGKSN------TQEDIQTMKVSKVFTHPQYNSNTIE 120

  Fly   124 YDAAILILDGDFEFNDAVQPIELAKERPDHDTPVT--VTGWGTTSEGGTIS-DVLQEVSVNVVDN 185
            .|.|::.|......|..|.|:.||:...:..:.:|  .:|||.|......: |.||:|::.::.|
Zfish   121 NDIALVKLTAPASLNAHVSPVCLAEASDNFASGMTCVTSGWGVTRYNALFTPDELQQVALPLLSN 185

  Fly   186 SNCKNAYSIMLTSRMLCAGVNGGGKDACQGDSGGPLVYNN----TLLGIVSWGTGCAREKYPGVY 246
            .:|||.:...:...|:|||  ..|..:|.||||||||...    ||:||||||:.......||||
Zfish   186 EDCKNHWGSNIRDTMICAG--AAGASSCMGDSGGPLVCQKDNIWTLVGIVSWGSSRCDPTMPGVY 248

  Fly   247 CSVPDVLDWLVETVA 261
            ..|.::.||:.:.:|
Zfish   249 GRVTELRDWVDQILA 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lambdaTryNP_610673.1 Tryp_SPc 35..255 CDD:214473 76/235 (32%)
Tryp_SPc 36..259 CDD:238113 77/238 (32%)
ctrb.3NP_001017724.1 Tryp_SPc 33..258 CDD:214473 77/236 (33%)
Tryp_SPc 34..261 CDD:238113 77/238 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.