DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lambdaTry and Prss33

DIOPT Version :9

Sequence 1:NP_610673.1 Gene:lambdaTry / 36214 FlyBaseID:FBgn0043470 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_001102497.1 Gene:Prss33 / 497873 RGDID:1583742 Length:277 Species:Rattus norvegicus


Alignment Length:244 Identity:80/244 - (32%)
Similarity:125/244 - (51%) Gaps:17/244 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 PKLDGRIVGGQDTNITQYPHQISMRYRGNHRCGGTIYRSNQIISAAHCVNTLSGPENLTIVAGSS 94
            |::..|||||:|....::|.|.|:::||.|.|||::.....:::|.||.:....|...:::.|:.
  Rat    28 PRMSSRIVGGRDAQDGEWPWQTSIQHRGAHVCGGSLIAPQWVLTAGHCFSRRVLPSEYSVLLGAL 92

  Fly    95 NIWFPTGPQQELEVREIIIHPKYRTLNNDYDAAILILDGDFEFNDAVQPIELAK--ERPDHDTPV 157
            ::...:..:..:.|..:::.|.|.......|.|:|.|......:..:||:.|..  ..|...:|.
  Rat    93 SLDVTSSHELLVPVLRVLLPPDYSEDEARGDLALLQLSHPVSLSARIQPVCLPAPGSHPPPGSPC 157

  Fly   158 TVTGWGTTSEGGTI--SDVLQEVSVNVVDNSNCKNAY----SIMLTSRM-----LCAGVNGGGKD 211
            .|||||:.|.|..:  ...||.|.|.::|:..|...|    ::..:.|:     ||||...|.||
  Rat   158 WVTGWGSLSPGVPLPKGRPLQGVRVPLLDSRACDRLYHMGANVPKSERIVLPGNLCAGYRRGHKD 222

  Fly   212 ACQGDSGGPLVYNNT----LLGIVSWGTGCAREKYPGVYCSVPDVLDWL 256
            ||||||||||....:    |:|:||||.|||....||||.:|.....|:
  Rat   223 ACQGDSGGPLTCMESGRWVLVGVVSWGKGCALPNRPGVYTNVAKYSPWI 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lambdaTryNP_610673.1 Tryp_SPc 35..255 CDD:214473 78/236 (33%)
Tryp_SPc 36..259 CDD:238113 78/238 (33%)
Prss33NP_001102497.1 Tryp_SPc 33..271 CDD:214473 78/237 (33%)
Tryp_SPc 34..272 CDD:238113 78/238 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.