DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lambdaTry and Prss36

DIOPT Version :9

Sequence 1:NP_610673.1 Gene:lambdaTry / 36214 FlyBaseID:FBgn0043470 Length:272 Species:Drosophila melanogaster
Sequence 2:XP_038942639.1 Gene:Prss36 / 497040 RGDID:1593186 Length:874 Species:Rattus norvegicus


Alignment Length:261 Identity:87/261 - (33%)
Similarity:125/261 - (47%) Gaps:33/261 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 PKLDGRIVGGQDTNITQYPHQISMRYRGNHRCGGTIYRSNQIISAAHCV---NTLSGPENLTIVA 91
            |:...|||||.|.:...:|.|:|:.:.|.|.|||::...:.::|||||.   .||...:..:::.
  Rat    53 PEPSSRIVGGSDAHPGTWPWQVSLHHGGGHICGGSLIAPSWVLSAAHCFVTNGTLEPADEWSVLL 117

  Fly    92 GSSNIWFPTGPQQELEVRE---IIIHPKYRTLNNDYDAAILILDGDFEFNDAVQPIEL--AKERP 151
            |   :....||.:...:|.   |::...|..:....|.|:|.|....:...:|:|:.|  |....
  Rat   118 G---VHSQDGPLEGAHMRSVATILVPDNYSRVELGADLALLRLASPAKLGPSVKPVCLPRASHLF 179

  Fly   152 DHDTPVTVTGWGTTSEGGTISD------VLQEVSVNVVDNSNCKNAYS--------IMLTSRMLC 202
            .|.|....||||...|    ||      |||||.:.::..:.|:..||        :.|...|||
  Rat   180 AHGTACWATGWGDVQE----SDPLPVPWVLQEVELKLLGETACQCLYSRPGPFNLTLQLLPGMLC 240

  Fly   203 AGVNGGGKDACQGDSGGPLVYNN----TLLGIVSWGTGCAREKYPGVYCSVPDVLDWLVETVADK 263
            ||...|.:|.||||||||||..:    .|.||.|:|.||.|...|||:.:|.....|:.|.|...
  Rat   241 AGYPEGRRDTCQGDSGGPLVCEDGGRWFLAGITSFGFGCGRRNRPGVFTAVAHYESWIREHVMGS 305

  Fly   264 E 264
            |
  Rat   306 E 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lambdaTryNP_610673.1 Tryp_SPc 35..255 CDD:214473 82/245 (33%)
Tryp_SPc 36..259 CDD:238113 82/248 (33%)
Prss36XP_038942639.1 Tryp_SPc 59..301 CDD:238113 82/248 (33%)
Tryp_SPc 338..532 CDD:419748
Tryp_SPc 607..802 CDD:419748
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166343296
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100031
Panther 1 1.100 - - O PTHR24276
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.