DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lambdaTry and tmprss2

DIOPT Version :9

Sequence 1:NP_610673.1 Gene:lambdaTry / 36214 FlyBaseID:FBgn0043470 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_001008623.1 Gene:tmprss2 / 494080 ZFINID:ZDB-GENE-041212-48 Length:486 Species:Danio rerio


Alignment Length:245 Identity:92/245 - (37%)
Similarity:128/245 - (52%) Gaps:35/245 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 RIVGGQDTNITQ---YPHQISMRYRGNHRCGGTIYRSNQIISAAHCVNTLSGPENLTIVAGSSNI 96
            |||||  |.:|.   :|.|:|:.|.|.|.|||:|.....|::|||||:..|.|...|:.||... 
Zfish   251 RIVGG--TTVTSKGVWPWQVSLHYSGRHLCGGSIITPYWILTAAHCVHQFSNPGGWTVYAGYLT- 312

  Fly    97 WFPTGPQQEL------EVREIIIHPKYRTLNNDYDAAILILDGDFEFNDAVQPIELAKERPDHDT 155
                  |.|:      .|..|:|| .:....|:.|.|::.|:.....:..::|:.|    |:...
Zfish   313 ------QSEMASASGNSVNRIVIH-DFNPNTNENDIALMRLNTALTISTNIRPVCL----PNKGM 366

  Fly   156 PVT------VTGWGTTSEGGTISDVLQEVSVNVVDNSNCKN--AYSIMLTSRMLCAGVNGGGKDA 212
            ..|      |||||....||:.|..|||..:.::|::.|.:  .|:.::|..|:|||...||.|:
Zfish   367 SFTAQQDCYVTGWGALFSGGSSSATLQEAKIQLIDSTICNSRPVYNGLITDTMICAGKLAGGVDS 431

  Fly   213 CQGDSGGPLVYNNT----LLGIVSWGTGCAREKYPGVYCSVPDVLDWLVE 258
            ||||||||||.|..    |||..|||.|||....||||.:|...|||:.:
Zfish   432 CQGDSGGPLVTNVRSLWWLLGDTSWGDGCAVRNKPGVYGNVTYFLDWIYQ 481

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lambdaTryNP_610673.1 Tryp_SPc 35..255 CDD:214473 90/240 (38%)
Tryp_SPc 36..259 CDD:238113 91/244 (37%)
tmprss2NP_001008623.1 LDLa 132..168 CDD:238060
SRCR_2 173..248 CDD:295335
Tryp_SPc 251..479 CDD:214473 91/241 (38%)
Tryp_SPc 252..482 CDD:238113 91/244 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.