DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lambdaTry and AgaP_AGAP012671

DIOPT Version :9

Sequence 1:NP_610673.1 Gene:lambdaTry / 36214 FlyBaseID:FBgn0043470 Length:272 Species:Drosophila melanogaster
Sequence 2:XP_001230557.2 Gene:AgaP_AGAP012671 / 4578478 VectorBaseID:AGAP012671 Length:216 Species:Anopheles gambiae


Alignment Length:204 Identity:59/204 - (28%)
Similarity:87/204 - (42%) Gaps:28/204 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 GGTIYRSNQIISAAHCV-NTLSGPENLTIVAGSSNIWFPTGPQQELEVREIIIHP----KYRTLN 121
            |.||......::||||| ...|.|..:::..||::.  .||......|| |.:||    .|....
Mosquito    11 GATIITHKHALTAAHCVYPQRSEPMRVSLYGGSTSA--VTGGVLFSVVR-IAVHPGYDHSYFPDA 72

  Fly   122 NDYDAAIL-ILDGDFEFNDAVQPIELAKERPDHDTPVTVTGWGTTSEGGTIS-DVLQEVSVNVVD 184
            ::||.|:| :.:..|.....:..:.|........|...|.|||.|......| :.|:...:.:||
Mosquito    73 SEYDVAVLTVANNAFSGKSNMASLILQTSEQPIGTRCFVAGWGRTGNNEPASLNQLRYAEMTIVD 137

  Fly   185 NSNCKNAYSI----MLTSRMLCAGVNGGGKDACQGDSGGPLVYNNTLLGIVS---------WGTG 236
            .|.|..|::.    .:||:..     |.|.|.|:|||||.||....|.|:||         |..|
Mosquito   138 QSTCARAWATYPRQRVTSKKY-----GNGVDTCKGDSGGALVCGGGLAGVVSFTNLECTSAWPAG 197

  Fly   237 CAREKYPGV 245
            .::...|.:
Mosquito   198 FSKISAPSI 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lambdaTryNP_610673.1 Tryp_SPc 35..255 CDD:214473 59/204 (29%)
Tryp_SPc 36..259 CDD:238113 59/204 (29%)
AgaP_AGAP012671XP_001230557.2 Tryp_SPc 11..203 CDD:214473 58/199 (29%)
Tryp_SPc 11..202 CDD:238113 58/198 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.