DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lambdaTry and AgaP_AGAP012502

DIOPT Version :9

Sequence 1:NP_610673.1 Gene:lambdaTry / 36214 FlyBaseID:FBgn0043470 Length:272 Species:Drosophila melanogaster
Sequence 2:XP_001230484.2 Gene:AgaP_AGAP012502 / 4578454 VectorBaseID:AGAP012502 Length:829 Species:Anopheles gambiae


Alignment Length:222 Identity:69/222 - (31%)
Similarity:106/222 - (47%) Gaps:24/222 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 NHRCGGTIYRSNQIISAAHCV---NTLSGPENLTIVAGSSNIWFPTGPQ--QELEVREIIIHPKY 117
            |..|||::..:|.|::||||.   :||..|:.:.|  |..|::......  ||..:..:|.||.|
Mosquito    43 NWNCGGSLIWANFILTAAHCTKDRDTLLPPDIIRI--GDLNLYDDREDALVQERTIIRVIRHPLY 105

  Fly   118 RTLNNDYDAAILILDGDFEFNDAVQPIELAKERPDHDTPVTVTGWGTTSEGGTISDVLQEVSVNV 182
            .|.:..||.|:|:|:........|.|..|..:.....:.|...||||:..|...:::|.:..:.:
Mosquito   106 NTSSVFYDIALLMLNEKVNIYFEVMPTCLWLDDNIPFSKVEAAGWGTSGFGYGKTNILIKAELKL 170

  Fly   183 VDNSNCKNAYSIM------LTSRMLCAGVNGGGKDACQGDSGGPLVYN--------NTLLGIVSW 233
            :.|.:|::.||.:      |....|||.  ....|.|.|||||||.:.        ..|:|:.|:
Mosquito   171 MANKDCESYYSQVASVKNGLMEHQLCAW--DKVMDTCPGDSGGPLQHKLIFGDYKVPFLVGVTSF 233

  Fly   234 GTGCAREKYPGVYCSVPDVLDWLVETV 260
            |..|...: ||||..|.....|:|||:
Mosquito   234 GLSCGNSQ-PGVYVKVSKFGSWIVETL 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lambdaTryNP_610673.1 Tryp_SPc 35..255 CDD:214473 65/215 (30%)
Tryp_SPc 36..259 CDD:238113 67/219 (31%)
AgaP_AGAP012502XP_001230484.2 Tryp_SPc 19..258 CDD:238113 67/219 (31%)
Tryp_SPc 19..255 CDD:214473 65/216 (30%)
Tryp_SPc 325..>418 CDD:304450
Trypsin 621..823 CDD:278516
Tryp_SPc 629..826 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.